KEGG   Mus caroli (Ryukyu mouse): 110292727
Entry
110292727         CDS       T05910                                 

Gene name
Irs1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04068  FoxO signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal05010  Alzheimer disease
mcal05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110292727 (Irs1)
   04022 cGMP-PKG signaling pathway
    110292727 (Irs1)
   04151 PI3K-Akt signaling pathway
    110292727 (Irs1)
   04152 AMPK signaling pathway
    110292727 (Irs1)
   04150 mTOR signaling pathway
    110292727 (Irs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110292727 (Irs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110292727 (Irs1)
   04923 Regulation of lipolysis in adipocytes
    110292727 (Irs1)
   04920 Adipocytokine signaling pathway
    110292727 (Irs1)
   04935 Growth hormone synthesis, secretion and action
    110292727 (Irs1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110292727 (Irs1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110292727 (Irs1)
  09149 Aging
   04211 Longevity regulating pathway
    110292727 (Irs1)
   04213 Longevity regulating pathway - multiple species
    110292727 (Irs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110292727 (Irs1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110292727 (Irs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110292727 (Irs1)
   04932 Non-alcoholic fatty liver disease
    110292727 (Irs1)
   04931 Insulin resistance
    110292727 (Irs1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110292727 (Irs1)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   110292727 (Irs1)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 110292727
NCBI-ProteinID: XP_021015916
Ensembl: MGP_CAROLIEiJ_G0014324
UniProt: A0A6P5PKI9
LinkDB
Position
1
AA seq 1230 aa
MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKAH
HDGAGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQVILKPKGLGQTKNLIGIYRL
CLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVV
AQNMHETILEAMRAMSDEFRPRSKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSRT
ESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSSRL
HPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGGF
ISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLAAPNGHYIL
SRGGNGHRYIPGANLGTSPALPGDEAAGAADLDNRFRKRTHSAGTSPTISHQKTPSQSSV
ASIEEYTEMMPAAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHHLERRGGHHRPDTS
NLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMM
MSPSGSCSPDIGGGSSSSSSISAAPSGSSYGKPWTNGVGGHHTHALPHAKPPVESGGGKL
LPCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGAR
HQHLRLSSSSGRLRYTTTAEDSSSSTSSDSLGGGYCGARPESNLTHPHHHVLQPHLPRKV
DTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQQQSSLHPPEPKSPGEYVNIEFGSGQ
PGYLAGPATSRSSPSVRCPPPLHPAPREETGSEEYMNMDLGPGRRATWQESGGVELGRIG
PAPPGSATVCRPTRSVPNSRGDYMTMQIGCPRQSYVDTSPVAPVSYADMRTGIAAEKASL
PRPTGAAPPPSSTASSSVTPQGATAEQATHSSLLGGPQGPGGMSAFTRVNLSPNHNQSAK
VIRADTQGCRRRHSSETFSAPTRAGNTVPFGAGAAVGGSGGGGGGSEDVKRHSSASFENV
WLRPGDVGGVSKESAPVCGAAGGLEKSLNYIDLDLAKERSQDCPSQQQSLPPPPPHQPLG
SNEGNSPRRSSEDLSNYASISFQKQPEDHQ
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggcaagccctccggataccgatggcttctcagacgtgcgcaaggtgggctacctgcgc
aaacccaagagtatgcataagcgctttttcgtgctgcgggcggccagcgaggccgggggc
ccagcgcgcctggagtattatgagaatgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgtttcaacatcaacaagcgggctgactccaagaac
aagcatctggtggctctctacacccgagacgaacactttgccattgcggcggatagcgag
gctgagcaagacagctggtaccaggctcttctgcagctgcataatcgggcaaaggcccac
catgacggggctggaggaggctgcggtggtagctgcagcggcagctctggcgttggagag
gcaggagaggacttgagctatgacacgggtccaggacccgcgttcaaggaggtctggcag
gttatcctgaaacccaagggcctgggtcagacaaagaacctgattggcatctaccgcctc
tgcctgaccagcaagaccatcagctttgtgaagctgaactccgaggcagccgctgtggtg
ctgcagctgatgaacatcagacgctgtggccactcagagaacttcttcttcatcgaggtg
gggcgttccgctgtgacagggcctggcgaattctggatgcaagtggatgactccgtggtg
gcccagaacatgcatgagaccattctagaggccatgcgggccatgagcgatgagtttcgc
cctcgcagcaaaagccagtcttcatccagttgctccaatcccatcagcgttcccctgcgc
aggcaccatctcaacaaccctccacccagccaggtgggactgactcggagatctcgaact
gagagcatcactgccacctcccctgccagtatggtgggtgggaaaccaggttccttccgg
gtgcgtgcctccagcgatggcgaaggcaccatgtcccgtccagcatcagtggatggcagt
cctgtgagccctagcaccaacaggacccacgcccatcggcatcgaggcagctccaggctg
caccccccactcaaccacagccgctccatccccatgccttcttcgcgatgctcaccttca
gccaccagcccagtgagtctgtcatctagtagtaccagtggccatggctccacttcagac
tgtctcttcccaaggcgctctagtgcttccgtgtccggttcgcctagcgatggcggtttc
atctcttctgatgagtatggttctagtccctgcgatttccgaagttccttccgcagtgtc
accccagattccctggggcacaccccaccagccaggggtgaggaggagctgagcaattat
atctgcatgggtggcaagggagcctccaccttggctgctcccaatggccactacattttg
tccaggggtggcaacggccatcgctacatcccaggtgctaacttggggacaagcccagcg
ctgcctggagatgaagccgcgggtgcagcagatctggataaccggtttcgaaagagaact
cactccgcaggcacatctcctaccatttcccatcagaagaccccctcacagtcttcagtg
gcttctattgaggaatatacagagatgatgcccgctgcctacccaccaggaggtggcagt
ggaggccgactgcccggctaccggcattccgccttcgtgcccacccactcctatcccgaa
gagggtctagagatgcaccacttggaacgtcgtggaggccaccaccgtccagacacctcc
aacctccacactgatgatggctacatgcccatgtctcctggggtggctccagtgcccagc
aaccgcaaaggaaatggggactatatgcccatgagccccaagagtgtatctgccccacag
cagatcattaaccccatcagacgccacccacagagagtggaccccaatggctacatgatg
atgtcacccagtggtagttgctcccctgacattggaggtgggtccagcagcagtagcagc
atcagtgcagccccttctgggagcagctatgggaagccatggacaaatggagtagggggg
caccatactcatgcccttcctcatgccaaacctcctgttgagagtggtggcggtaagctc
ttgccttgcacaggtgactacatgaacatgtccccagtgggagattccaacaccagcagc
ccctcagaatgctactatggcccagaagatccccagcacaagccggtcctctcttactac
tcattgccaaggtcctttaagcacacccagcgccctggagagccagaggagggtgccagg
caccagcatcttcgtctctcttctagctctggacgccttcgctataccacaactgccgaa
gattcctcctcttctaccagcagcgacagtctgggtgggggttactgtggggctaggcca
gagtctaacctcacacatccccaccaccatgtcttgcagccccacctgcctcgaaaggta
gacacagctgcacagaccaacagccgcctggctcgacccacaaggctgtccttgggggat
cccaaggcaagcaccttaccccgggttcgagagcagcaacagcagcaacagtcttccctg
caccctcccgagcccaaaagcccaggagaatatgtgaatattgaattcgggagcggccag
cctggctatttagctggccctgcaacttcccgtagctctccttcagttcgatgtccaccc
ccgctccacccagctcctagagaagagactggctcggaagagtacatgaacatggacttg
gggccaggccggagggcaacctggcaggagagtggtggagttgagttgggcagaataggc
cctgcacctccagggtctgctacggtttgcaggccaacccgttcggtgccaaatagccgt
ggtgactacatgaccatgcagataggttgtcctcgtcaaagctatgtggatacctctcca
gtggccccagtcagctatgctgacatgcggacaggcattgctgcagagaaggcgagcctg
cctagacccacaggagctgctcctcctccatcctccacagcctcttcttctgttacacct
caaggagccaccgctgagcaagctactcactcttccttgctgggaggccctcagggacct
gggggcatgagtgcattcaccagggtgaacctcagtcccaaccataaccagagtgccaaa
gtgattcgcgcagacactcaagggtgccggaggaggcatagctctgagaccttctcagca
cctactcgggctggcaatacggtgccctttggagcaggggctgcagtagggggcagcggt
ggtggtggtggcggcagtgaggatgtaaaacgccacagctctgcatcctttgagaatgtg
tggctgagacctggggatgtagggggagtctccaaggagtcggctccagtgtgtggggct
gctgggggtttggagaagagtcttaactacatagacctggatttggccaaggagcgctct
caggactgcccctctcaacagcagtccctaccaccccctccccctcaccagcccttaggc
agcaatgagggcaactccccaagacgctccagtgaggatttaagcaactatgccagcatc
agcttccagaagcagccagaggatcatcaatag

DBGET integrated database retrieval system