KEGG   Mus caroli (Ryukyu mouse): 110292743
Entry
110292743         CDS       T05910                                 

Gene name
Zbtb17
Definition
(RefSeq) zinc finger and BTB domain-containing protein 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110292743 (Zbtb17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292743 (Zbtb17)
   05202 Transcriptional misregulation in cancer
    110292743 (Zbtb17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110292743 (Zbtb17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110292743 (Zbtb17)
   04121 Ubiquitin system [BR:mcal04121]
    110292743 (Zbtb17)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    110292743 (Zbtb17)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     110292743 (Zbtb17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2HC_2 zf-C2H2_6 Zn-ribbon_8 zf-Di19 zf-BED zf-C2HE zinc_ribbon_15 zf_UBZ Packaging_FI HypA DUF3342 XPA_N
Other DBs
NCBI-GeneID: 110292743
NCBI-ProteinID: XP_021015935
Ensembl: MGP_CAROLIEiJ_G0026744
UniProt: A0A6P5PQI5
LinkDB
Position
4
AA seq 794 aa
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVASFLQMQDIVTACHTLKSLAEPTST
TGESADASAVEGGDKRAKDEKATATMLSRLDQARGSSSTGPGRELKEERGGQAESASSGA
EQTEKADAPREPPPVELKPDPTSSMAAAEAEALSESSEQEMEVEPASKGEDGQEEEGAGP
ATVKEEGMLLDNGEPPEENEESAGTDSGQELGMEGQNLRSGTYGDRTESKAYGSIIHKCE
DCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGK
SYRLISLLNLHKKRHSGEARYRCGDCGKLFTTSGNLKRHQLVHSGQKPYQCDYCGRSFSD
PTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNL
KRHLRIHSGEKPYVCTHCQRQFADPGALQRHVRIHTGEKPCQCVICGKAFTQASSLIAHV
RQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHT
GEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEA
LAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDA
NSLAQHVRIHTAQALVMFQTDADFYQQYGPGSTWPAGQMLQAGELVFRPRDGTEGQPTLA
ESPPTAPDCLPPAE
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggatttcccccagcacagccagcatgtcttggagcagctgaaccagcagcggcaactg
ggcctcctctgtgactgcacctttgtggtggacggcgttgacttcaaggctcacaaggcg
gtgctggcagcttgcagcgagtacttcaagatgctctttgtggaccagaaggacgtggtg
cacctagacatcagtaatgcggcaggcctggggcaggtgctggagttcatgtacactgct
aagctgagccttagccctgagaacgtggacgatgttctggccgtggccagcttccttcag
atgcaggatattgtcacagcctgccacactctcaagtccctcgctgagccgaccagcacc
actggggagagcgcagatgcctcagctgtggaaggaggagacaagagagccaaagacgag
aaggccactgccaccatgctgagcaggctggaccaagcaagaggcagctcctccacaggc
ccaggcagagaactcaaggaggagcggggtggccaggcagaaagtgcatccagtggcgca
gagcagacggagaaggcagacgctccccgggagcctccacctgtggagctcaagccggac
cccacaagcagcatggcggctgcagaagccgaagccttatcagagagctcagagcaagaa
atggaagtggagccagccagcaaaggagaagacggacaagaggaagagggtgcagggcct
gccacagtcaaggaagaggggatgcttctggataacggggagcctcctgaggagaacgaa
gagtctgccggcacagattctgggcaggagcttggcatggagggtcagaacctgcgctcg
ggcacctacggggatcgcactgagtccaaggcttacggctccatcatccacaagtgcgag
gactgcgggaaggagttcacgcacacagggaacttcaaacggcacatccgcatccacacg
ggcgagaaacctttctcatgcagggagtgcagcaaggctttctcggaccccgcagcgtgc
aaggctcacgagaagacacacagcccgttgaaaccctatgggtgtgaggagtgtggcaag
agctacaggctcatcagcctgctgaacctgcacaagaagaggcactccggggaggcgcgc
taccgctgcggggactgtggcaagctcttcaccacttcaggcaacctcaagcgccaccag
ctggtacacagtggccagaaaccctaccagtgcgactactgtggccgctccttctctgac
cccacctctaagatgcgccacctggagactcatgacaccgacaaggagcacaagtgtcct
cactgcgacaaaaagttcaaccaggtggggaacctgaaggcccacttgaagatccacatt
gccgatggccctctcaagtgccgggagtgcgggaagcagttcaccacctcagggaacctc
aagcggcacctgcggatccacagcggggagaagccgtacgtatgcacccactgtcagcgg
cagtttgccgacccaggcgcgctgcagcggcacgtccggatccacacgggtgagaagccg
tgccagtgtgtgatatgtggtaaggccttcacccaagccagctccctcatcgcccacgta
cgccaacacacgggggagaagccctacgtctgtgaacgctgtggcaagagatttgtccag
tccagccagttggccaaccacatccgtcaccatgacaacatccgaccacacaagtgcagc
gtgtgtagcaaggccttcgtgaatgtgggggacctgtccaagcacattatcatccacacc
ggagagaagccttatttgtgtgacaagtgtggccgtggtttcaaccgggtagacaacctg
cgttctcatgtaaagaccgtgcatcagggcaaggcgggcatcaagatcctggagccagaa
gagggtggtgaggtcagcgtggtcactgtggacgacatggtcaccctggccactgaggct
ctggcagcgacagcggtcactcagctcacagtggtaccagtgggggccgcagtgacagct
gacgagacggaagtactcaaagctgagatcagcaaagctgtcaagcaagtgcaggaagaa
gaccccaacacccacatcctctacgcttgtgattcctgtggggacaagttcctggatgcc
aatagcctagcccagcatgttcggatccacacagcccaggcactggtcatgttccagacg
gatgcggacttctaccagcagtatgggccaggcagcacgtggccagccgggcagatgctg
caggctggagagctcgtcttccgtcctagggatgggactgagggccaacccacactggca
gaaagtccacccacagctcctgattgcctaccacctgccgagtga

DBGET integrated database retrieval system