KEGG   Mus caroli (Ryukyu mouse): 110292857
Entry
110292857         CDS       T05910                                 

Gene name
Cdkn2c
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor C isoform X1
  KO
K06622  cyclin-dependent kinase inhibitor 2C
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04110  Cell cycle
mcal04934  Cushing syndrome
mcal05166  Human T-cell leukemia virus 1 infection
mcal05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110292857 (Cdkn2c)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110292857 (Cdkn2c)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110292857 (Cdkn2c)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110292857 (Cdkn2c)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110292857 (Cdkn2c)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 DUF1843
Other DBs
NCBI-GeneID: 110292857
NCBI-ProteinID: XP_021016144
Ensembl: MGP_CAROLIEiJ_G0026286
UniProt: A0A6P5PEX8
LinkDB
Position
4
AA seq 208 aa
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQAASPDADRFATEKSRDE
GRLTEQKPLLCAEKDSTECLTNRVMKLGNPEIARRLLLRGANPNLKDGTGFAVIHDAARA
GFLDTVQALLEFQADVNIEDNEGNLPLHLAAKEGHLPVVEFLMKHTACNVGHRNHKGDTA
FDLARFYGRNEVISLMEANGVGGATSLQ
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa
cttactagtttgttgcaaaataatgtaaacgtcaacgctcaaaatggatttgggagaact
gcgctgcaggcagcaagtccagatgctgacaggtttgctactgagaagtcaagagatgag
ggccgcctcacagagcagaagccacttctgtgtgcagaaaaagacagcacagagtgtttg
acaaatagggttatgaaacttggaaatccggagattgccaggaggcttctcctcagaggt
gctaatcccaatttgaaagatggaactggttttgctgtcattcacgatgctgccagagca
ggtttcctggacactgtacaggctttgctggagttccaggctgatgttaacattgaagat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccctgtggtggag
ttccttatgaagcacacagcctgcaatgtggggcatcggaaccataagggggacaccgcc
ttcgacttggccaggttctatggaagaaatgaggtcattagcctgatggaggcaaatggg
gttgggggagccacaagcctgcagtga

DBGET integrated database retrieval system