KEGG   Mus caroli (Ryukyu mouse): 110292955
Entry
110292955         CDS       T05910                                 

Gene name
Tgfb2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04218  Cellular senescence
mcal04350  TGF-beta signaling pathway
mcal04380  Osteoclast differentiation
mcal04390  Hippo signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05144  Malaria
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05220  Chronic myeloid leukemia
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05321  Inflammatory bowel disease
mcal05323  Rheumatoid arthritis
mcal05410  Hypertrophic cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110292955 (Tgfb2)
   04350 TGF-beta signaling pathway
    110292955 (Tgfb2)
   04390 Hippo signaling pathway
    110292955 (Tgfb2)
   04068 FoxO signaling pathway
    110292955 (Tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110292955 (Tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110292955 (Tgfb2)
   04218 Cellular senescence
    110292955 (Tgfb2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110292955 (Tgfb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292955 (Tgfb2)
   05206 MicroRNAs in cancer
    110292955 (Tgfb2)
   05205 Proteoglycans in cancer
    110292955 (Tgfb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110292955 (Tgfb2)
   05212 Pancreatic cancer
    110292955 (Tgfb2)
   05225 Hepatocellular carcinoma
    110292955 (Tgfb2)
   05226 Gastric cancer
    110292955 (Tgfb2)
   05220 Chronic myeloid leukemia
    110292955 (Tgfb2)
   05211 Renal cell carcinoma
    110292955 (Tgfb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110292955 (Tgfb2)
   05321 Inflammatory bowel disease
    110292955 (Tgfb2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110292955 (Tgfb2)
   05414 Dilated cardiomyopathy
    110292955 (Tgfb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110292955 (Tgfb2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110292955 (Tgfb2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110292955 (Tgfb2)
   05161 Hepatitis B
    110292955 (Tgfb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110292955 (Tgfb2)
   05144 Malaria
    110292955 (Tgfb2)
   05145 Toxoplasmosis
    110292955 (Tgfb2)
   05140 Leishmaniasis
    110292955 (Tgfb2)
   05142 Chagas disease
    110292955 (Tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110292955 (Tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110292955 (Tgfb2)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110292955 (Tgfb2)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110292955 (Tgfb2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 110292955
NCBI-ProteinID: XP_021016312
Ensembl: MGP_CAROLIEiJ_G0015026
UniProt: A0A6P5PJZ4
LinkDB
Position
1
AA seq 442 aa
MHYCVLSTFLLLHLVPVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
DEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHFPSETVCPV
VTTPSGSVGSFCSRQSQVLCGYLDAIPPTFYRPYFRTVRFDVSTMEKNASNLVKAEFRVF
RLQNPKARVAEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVQEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYASGDQKTIKSTRK
KTSGKTPHLLLMLLPSYRLESQQSSRRRKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGNTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcacctttttgctcctgcatctggtcccggtggcgctcagt
ctgtctacctgcagcaccctcgacatggatcagtttatgcgcaagaggatcgaggccatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccggaagactatccggagccg
gatgaggtccccccggaggtgatttccatctacaacagtaccagggacttactgcaggag
aaggcaagccggagggcagccgcctgcgagcgcgagcggagcgacgaggagtactacgcc
aaggaggtttataaaatcgacatgccgtcccacttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttttgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaaccgtccgcttt
gatgtctcaacaatggagaaaaatgcttcgaatctggtgaaggcagagttcagggtcttc
cgcttgcaaaaccccaaagccagagtggccgagcagcggattgaactgtaccagatcctt
aaatccaaagacttaacatctcccacccagcgctacatcgatagcaaggttgtgaaaacc
agagcggagggtgaatggctctccttcgacgtgacagacgctgtgcaggagtggcttcac
cacaaagacaggaacctggggtttaaaataagtttacactgcccctgctgtacctttgtg
ccgtctaataattacatcatcccgaataaaagcgaagagctcgaggcgagattcgcaggt
attgatggcacctctacatatgccagtggtgaccagaaaactataaagtccactaggaaa
aaaaccagtgggaagaccccacatctcctgctaatgttgttgccctcctacagactggag
tcacaacagtccagccggcggaggaagcgtgctttggatgctgcctattgctttagaaat
gtgcaggataattgctgccttcgccctctttacattgattttaagagggatcttggatgg
aaatggatccatgaacccaaagggtacaatgctaacttctgtgctggggcatgcccatat
ctatggagttcagacactcaacacaccaaagtcctcagcctgtacaacaccataaatccc
gaagcttccgcttccccttgctgtgtgtcccaggatctggaaccactgaccattctctac
tacattggaaatacacccaagatcgagcagctttccaatatgattgtcaagtcctgtaaa
tgcagctaa

KEGG   Mus caroli (Ryukyu mouse): 110298438
Entry
110298438         CDS       T05910                                 

Gene name
Tgfb1
Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04218  Cellular senescence
mcal04350  TGF-beta signaling pathway
mcal04380  Osteoclast differentiation
mcal04390  Hippo signaling pathway
mcal04659  Th17 cell differentiation
mcal04672  Intestinal immune network for IgA production
mcal04926  Relaxin signaling pathway
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05144  Malaria
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05220  Chronic myeloid leukemia
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05321  Inflammatory bowel disease
mcal05323  Rheumatoid arthritis
mcal05410  Hypertrophic cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110298438 (Tgfb1)
   04350 TGF-beta signaling pathway
    110298438 (Tgfb1)
   04390 Hippo signaling pathway
    110298438 (Tgfb1)
   04068 FoxO signaling pathway
    110298438 (Tgfb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110298438 (Tgfb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110298438 (Tgfb1)
   04218 Cellular senescence
    110298438 (Tgfb1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110298438 (Tgfb1)
   04672 Intestinal immune network for IgA production
    110298438 (Tgfb1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110298438 (Tgfb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110298438 (Tgfb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298438 (Tgfb1)
   05205 Proteoglycans in cancer
    110298438 (Tgfb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110298438 (Tgfb1)
   05212 Pancreatic cancer
    110298438 (Tgfb1)
   05225 Hepatocellular carcinoma
    110298438 (Tgfb1)
   05226 Gastric cancer
    110298438 (Tgfb1)
   05220 Chronic myeloid leukemia
    110298438 (Tgfb1)
   05211 Renal cell carcinoma
    110298438 (Tgfb1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110298438 (Tgfb1)
   05321 Inflammatory bowel disease
    110298438 (Tgfb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110298438 (Tgfb1)
   05414 Dilated cardiomyopathy
    110298438 (Tgfb1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110298438 (Tgfb1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110298438 (Tgfb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110298438 (Tgfb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110298438 (Tgfb1)
   05161 Hepatitis B
    110298438 (Tgfb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110298438 (Tgfb1)
   05144 Malaria
    110298438 (Tgfb1)
   05145 Toxoplasmosis
    110298438 (Tgfb1)
   05140 Leishmaniasis
    110298438 (Tgfb1)
   05142 Chagas disease
    110298438 (Tgfb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcal03110]
    110298438 (Tgfb1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110298438 (Tgfb1)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110298438 (Tgfb1)
Chaperones and folding catalysts [BR:mcal03110]
 Intramolecular chaperones
  Others
   110298438 (Tgfb1)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110298438 (Tgfb1)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110298438 (Tgfb1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110298438
NCBI-ProteinID: XP_021023343
Ensembl: MGP_CAROLIEiJ_G0029379
UniProt: A0A6P5Q1D8
LinkDB
Position
7
AA seq 390 aa
MPPSGLRLLPLLLPLPWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMVDRNNAI
YEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNNSWR
YLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
PKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctactgccgcttctgctcccactcccgtggcttctagtg
ctgacgcccgggaggccagccgcgggactctccacctgcaagaccatcgacatggagctg
gtgaaacggaagcgcatcgaagccatccgtggccagatcctgtccaaactaaggctcgcc
agtcccccaagccagggggaggtaccgcccggcccgctgcccgaggcggtgctcgctttg
tacaacagcacccgcgaccgggtggcaggcgagagtgccgacccggagccggagcccgaa
gcggactactatgctaaagaggtcacccgcgtgctaatggtggaccgcaacaacgccatc
tatgagaaaaccaaagacatctcacacagtatatatatgttcttcaatacgtcagacatt
cgggaagcagtgccggaacccccattgctgtcccgtgcagagctgcgcttgcagagatta
aaatcaagtgtggagcaacatgtggaactctaccagaaatatagcaacaattcctggcgt
taccttggtaaccggctgctgacccccactgatacgcctgagtggctgtcttttgatgtc
actggagttgtacggcagtggctgaaccaaggagacggaattcagggctttcgcttcagc
gctcactgctcttgtgacagcaaagataacaaactccacgtggaaatcaacgggatcagt
cccaaacgtcgaggagacctgggcaccatccatgacatgaaccgacccttcctgctcctc
atggccacccccctggaaagggcccagcacctgcacagctcacggcaccggagagccctg
gataccaactattgcttcagctccacagagaagaactgctgtgtgcggcagctgtacatc
gactttaggaaggacctgggttggaagtggatccacgagcccaagggctaccatgccaac
ttctgtctgggaccctgcccctacatctggagcctggacacacagtacagcaaggtcctt
gccctctacaaccaacacaacccgggcgcttcggcgtcaccgtgctgcgtgccgcaggct
ttggagccactgcccatcgtctactacgtgggtcgcaagcccaaggtggagcagttgtcc
aacatgattgtgcgctcctgcaagtgcagctga

KEGG   Mus caroli (Ryukyu mouse): 110306834
Entry
110306834         CDS       T05910                                 

Gene name
Tgfb3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04218  Cellular senescence
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05144  Malaria
mcal05145  Toxoplasmosis
mcal05146  Amoebiasis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05220  Chronic myeloid leukemia
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05321  Inflammatory bowel disease
mcal05323  Rheumatoid arthritis
mcal05410  Hypertrophic cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110306834 (Tgfb3)
   04350 TGF-beta signaling pathway
    110306834 (Tgfb3)
   04390 Hippo signaling pathway
    110306834 (Tgfb3)
   04068 FoxO signaling pathway
    110306834 (Tgfb3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110306834 (Tgfb3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110306834 (Tgfb3)
   04218 Cellular senescence
    110306834 (Tgfb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306834 (Tgfb3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110306834 (Tgfb3)
   05212 Pancreatic cancer
    110306834 (Tgfb3)
   05225 Hepatocellular carcinoma
    110306834 (Tgfb3)
   05226 Gastric cancer
    110306834 (Tgfb3)
   05220 Chronic myeloid leukemia
    110306834 (Tgfb3)
   05211 Renal cell carcinoma
    110306834 (Tgfb3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110306834 (Tgfb3)
   05321 Inflammatory bowel disease
    110306834 (Tgfb3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110306834 (Tgfb3)
   05414 Dilated cardiomyopathy
    110306834 (Tgfb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110306834 (Tgfb3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110306834 (Tgfb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110306834 (Tgfb3)
   05161 Hepatitis B
    110306834 (Tgfb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110306834 (Tgfb3)
   05144 Malaria
    110306834 (Tgfb3)
   05145 Toxoplasmosis
    110306834 (Tgfb3)
   05140 Leishmaniasis
    110306834 (Tgfb3)
   05142 Chagas disease
    110306834 (Tgfb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110306834 (Tgfb3)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110306834 (Tgfb3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110306834
NCBI-ProteinID: XP_021034624
Ensembl: MGP_CAROLIEiJ_G0017973
UniProt: A0A6P5QTF2
LinkDB
Position
12
AA seq 412 aa
MKMHLQRALVVLALLNLATISLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQETSESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NVHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDSPGQGSQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtagtcctggccctgctgaacttggccacaatc
agcctctctctgtccacttgcaccacgttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccgtcg
gtgatgacccacgtcccctatcaggtcctggcactttacaacagcacccgggagttgctg
gaagagatgcacggggagagggaggaaggctgcactcaggagacctcggagtccgagtac
tatgccaaagagatccataaattcgacatgatccaggggctggcggagcacaatgaactg
gccgtctgccccaaaggaattacctctaaggtttttcgtttcaatgtgtcctcagtggag
aaaaatggaaccaatctgttccgggcagagttccgggtcttgcgggtgcccaaccccagc
tccaagcgcacagagcagagaattgagctcttccagatacttcgaccggatgagcacata
gccaagcagcgctacataggtggcaagaatctgcccacaaggggcaccgctgagtggctg
tcttttgatgtcactgacactgtgcgcgagtggctgttgcggagagagtccaacttgggt
ctggaaatcagcatccactgtccatgtcacacctttcagcccaatggagacatactggaa
aatgttcatgaggtgatggaaatcaaattcaaaggagtggacaatgaagatgaccatggc
cgtggagacctggggcgtctcaagaagcagaaggatcaccacaacccgcacctgatcctc
atgatgatccccccacaccgactggacagcccaggccagggcagtcagaggaagaagagg
gccctggacaccaattactgcttccgcaacctggaggagaactgctgtgtacgccccctc
tatattgacttccggcaggatctaggctggaaatgggtccatgaacctaagggttactat
gccaacttctgctcaggcccttgcccatacctccgcagcgcagatacaacccacagcacg
gtgcttggactatacaacaccctgaacccagaggcgtctgcctcgccttgctgcgtaccc
caggacctggagcccctgaccatcttgtactatgtgggcagaacccccaaggtggagcag
ttgtccaacatggtggtgaagtcgtgtaagtgcagctga

DBGET integrated database retrieval system