KEGG   Mus caroli (Ryukyu mouse): 110293174
Entry
110293174         CDS       T05910                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04218  Cellular senescence
mcal04934  Cushing syndrome
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05212  Pancreatic cancer
mcal05214  Glioma
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110293174
   04115 p53 signaling pathway
    110293174
   04218 Cellular senescence
    110293174
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293174
   05206 MicroRNAs in cancer
    110293174
   05203 Viral carcinogenesis
    110293174
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110293174
   05225 Hepatocellular carcinoma
    110293174
   05214 Glioma
    110293174
   05220 Chronic myeloid leukemia
    110293174
   05218 Melanoma
    110293174
   05219 Bladder cancer
    110293174
   05223 Non-small cell lung cancer
    110293174
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110293174
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110293174
   05163 Human cytomegalovirus infection
    110293174
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110293174
   01522 Endocrine resistance
    110293174
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2
Other DBs
NCBI-GeneID: 110293174
NCBI-ProteinID: XP_021016643
Ensembl: MGP_CAROLIEiJ_G0026156
UniProt: A0A6P5PS50
LinkDB
Position
4
AA seq 168 aa
MESAADRLARAAAQGRVQDVRALLEAGVSPNAPNSFGRTPIQVMMMGNVHVAALLLNYGA
DSNCEDPTTLSRPVHDAAREGFLDTLVVLHASGAWLDVRDAWGRLPLDLAQERGHQDVVR
YLRSAGWSLCPAGWSLCTAGNVAQTDGHSFSSSTPRALGLRGQSQEQS
NT seq 507 nt   +upstreamnt  +downstreamnt
atggagtccgctgcagacagactggccagggcggcggcccagggccgcgtgcaagacgtg
cgggcactgctggaagccggggtttcgcccaacgccccgaactctttcggtcgtaccccg
attcaggtgatgatgatgggcaacgttcacgtagcagctcttctgctcaactacggtgca
gattcgaactgcgaggaccccaccaccctctcccgcccggtgcacgacgcagcgcgggaa
ggcttcctggacacgctggtggtgctgcacgcgtcaggggcttggctggatgtgcgcgat
gcctggggtcgcctgccgctcgacttggcccaagagcggggacatcaagacgtcgtgcga
tatttgcgttccgctgggtggtctttgtgtcccgctgggtggtctttgtgtaccgctggg
aacgtcgcccagaccgacgggcatagcttcagctcaagcacgcccagggccctgggactt
cgcggccaatcccaagagcagagctaa

DBGET integrated database retrieval system