KEGG   Mus caroli (Ryukyu mouse): 110293440
Entry
110293440         CDS       T05910                                 

Gene name
Casp9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04115  p53 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04370  VEGF signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05134  Legionellosis
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110293440 (Casp9)
   04151 PI3K-Akt signaling pathway
    110293440 (Casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110293440 (Casp9)
   04215 Apoptosis - multiple species
    110293440 (Casp9)
   04115 p53 signaling pathway
    110293440 (Casp9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110293440 (Casp9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293440 (Casp9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110293440 (Casp9)
   05212 Pancreatic cancer
    110293440 (Casp9)
   05215 Prostate cancer
    110293440 (Casp9)
   05213 Endometrial cancer
    110293440 (Casp9)
   05222 Small cell lung cancer
    110293440 (Casp9)
   05223 Non-small cell lung cancer
    110293440 (Casp9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110293440 (Casp9)
   05012 Parkinson disease
    110293440 (Casp9)
   05014 Amyotrophic lateral sclerosis
    110293440 (Casp9)
   05016 Huntington disease
    110293440 (Casp9)
   05020 Prion disease
    110293440 (Casp9)
   05022 Pathways of neurodegeneration - multiple diseases
    110293440 (Casp9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110293440 (Casp9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110293440 (Casp9)
   05152 Tuberculosis
    110293440 (Casp9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110293440 (Casp9)
   05161 Hepatitis B
    110293440 (Casp9)
   05160 Hepatitis C
    110293440 (Casp9)
   05164 Influenza A
    110293440 (Casp9)
   05162 Measles
    110293440 (Casp9)
   05168 Herpes simplex virus 1 infection
    110293440 (Casp9)
   05163 Human cytomegalovirus infection
    110293440 (Casp9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110293440 (Casp9)
   05169 Epstein-Barr virus infection
    110293440 (Casp9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110293440 (Casp9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110293440 (Casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110293440 (Casp9)
   01002 Peptidases and inhibitors [BR:mcal01002]
    110293440 (Casp9)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     110293440 (Casp9)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110293440 (Casp9)
Peptidases and inhibitors [BR:mcal01002]
 Cysteine peptidases
  Family C14: caspase family
   110293440 (Casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 110293440
NCBI-ProteinID: XP_021016921
Ensembl: MGP_CAROLIEiJ_G0026754
LinkDB
Position
4
AA seq 365 aa
MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQAGSGSWQDQAMQLVT
DLETRGRQALPLFISCLEDTGQGTLASVLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLT
AKEQRVVKLDXSQPALGNLTPVVLGPEELWPARLKPEVLRPETPRLVDIGSGGAHDVCAP
GKIRGHXDMAYTLDSDPCGHCLIINNVNFCPSSGLRTRTGSNVDRDKLEHRFRWLRFMVE
VKNDLTAKKMITALMEMGHQDHRALDCFVVVILSHGCQASHLQFLGAVYGTDGCSVSIEK
IVNIFNGNGCPSLGGKPKLFFIQACGGDTRLGILTLQLEVTPSPPAHTMLVFTELPHQLA
LEQVA
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggacgaggcggaccggcagctcctgcggcgatgcagggtgcgcctagtgagcgagctg
caagtcgcggagctctgggacgctctgctgagtcgagagctcttcacgcgcgacatgatc
gaggatattcagcaggcaggctctgggtcttggcaggatcaggccatgcagctggtcaca
gaccttgagacccgagggaggcaggcccttcctctcttcatctcctgcttagaggacaca
ggccaaggcaccctggcttcagtcttacaaagcggtcggcaagcagccaagcaggatcca
gaggctgttaaacccctagaccacctggtgcctgtggtcctgggaccaatgggactcaca
gcaaaggagcagagagttgtgaagctggaccngtcacagcctgccttgggaaacctcacc
ccagtggtgctggggccagaagagctctggcctgctcgcctcaagccagaggttctcaga
ccagaaacacccaggctggtggacattggttctggcggagctcatgatgtctgtgctcca
gggaagatcaggggacatgnagatatggcatacaccctggattcggatccctgtggccac
tgcctcatcatcaacaatgtgaacttctgcccttcctcggggctccgcacacgcaccggc
tccaacgtggaccgtgacaaacttgagcaccgtttccgctggctgcgcttcatggtggag
gtgaagaacgacctgactgccaagaaaatgatcacggctttaatggagatggggcaccag
gaccaccgtgccctggactgctttgtggtggtcatcctctctcacggctgccaggccagt
cacctccagttcctgggtgctgtctatgggacagatggatgctctgtgtccattgagaaa
attgtgaacatcttcaacgggaatggctgccccagcctgggagggaagcccaagctcttc
ttcatccaggcctgcggtggtgacacccgactggggatactcacattgcagctggaggtc
acgccatcgccaccagcgcacaccatgctggtcttcacagagcttccccaccagctagcg
ctggagcaggtggcatag

DBGET integrated database retrieval system