Mus caroli (Ryukyu mouse): 110293440 Help Entry 110293440         CDS       T05910                                  Gene name Casp9 Definition (RefSeq) caspase-9   KO K04399   caspase 9 [EC:3.4.22.62] Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal01524   Platinum drug resistance mcal04115   p53 signaling pathway mcal04151   PI3K-Akt signaling pathway mcal04210   Apoptosis mcal04215   Apoptosis - multiple species mcal04370   VEGF signaling pathway mcal04919   Thyroid hormone signaling pathway mcal05010   Alzheimer disease mcal05012   Parkinson disease mcal05014   Amyotrophic lateral sclerosis mcal05016   Huntington disease mcal05020   Prion disease mcal05022   Pathways of neurodegeneration - multiple diseases mcal05134   Legionellosis mcal05145   Toxoplasmosis mcal05152   Tuberculosis mcal05160   Hepatitis C mcal05161   Hepatitis B mcal05162   Measles mcal05163   Human cytomegalovirus infection mcal05164   Influenza A mcal05167   Kaposi sarcoma-associated herpesvirus infection mcal05168   Herpes simplex virus 1 infection mcal05169   Epstein-Barr virus infection mcal05170   Human immunodeficiency virus 1 infection mcal05200   Pathways in cancer mcal05210   Colorectal cancer mcal05212   Pancreatic cancer mcal05213   Endometrial cancer mcal05215   Prostate cancer mcal05222   Small cell lung cancer mcal05223   Non-small cell lung cancer mcal05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04370 VEGF signaling pathway     110293440 (Casp9)    04151 PI3K-Akt signaling pathway     110293440 (Casp9)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110293440 (Casp9)    04215 Apoptosis - multiple species     110293440 (Casp9)    04115 p53 signaling pathway     110293440 (Casp9)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     110293440 (Casp9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110293440 (Casp9)   09162 Cancer: specific types    05210 Colorectal cancer     110293440 (Casp9)    05212 Pancreatic cancer     110293440 (Casp9)    05215 Prostate cancer     110293440 (Casp9)    05213 Endometrial cancer     110293440 (Casp9)    05222 Small cell lung cancer     110293440 (Casp9)    05223 Non-small cell lung cancer     110293440 (Casp9)   09164 Neurodegenerative disease    05010 Alzheimer disease     110293440 (Casp9)    05012 Parkinson disease     110293440 (Casp9)    05014 Amyotrophic lateral sclerosis     110293440 (Casp9)    05016 Huntington disease     110293440 (Casp9)    05020 Prion disease     110293440 (Casp9)    05022 Pathways of neurodegeneration - multiple diseases     110293440 (Casp9)   09166 Cardiovascular disease    05416 Viral myocarditis     110293440 (Casp9)   09171 Infectious disease: bacterial    05134 Legionellosis     110293440 (Casp9)    05152 Tuberculosis     110293440 (Casp9)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110293440 (Casp9)    05161 Hepatitis B     110293440 (Casp9)    05160 Hepatitis C     110293440 (Casp9)    05164 Influenza A     110293440 (Casp9)    05162 Measles     110293440 (Casp9)    05168 Herpes simplex virus 1 infection     110293440 (Casp9)    05163 Human cytomegalovirus infection     110293440 (Casp9)    05167 Kaposi sarcoma-associated herpesvirus infection     110293440 (Casp9)    05169 Epstein-Barr virus infection     110293440 (Casp9)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110293440 (Casp9)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110293440 (Casp9)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcal01009]     110293440 (Casp9)    01002 Peptidases and inhibitors [BR:mcal01002]     110293440 (Casp9) Enzymes [BR:mcal01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.62  caspase-9      110293440 (Casp9) Protein phosphatases and associated proteins [BR:mcal01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      110293440 (Casp9) Peptidases and inhibitors [BR:mcal01002]  Cysteine peptidases   Family C14: caspase family    110293440 (Casp9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 CARD CARD_2 Motif Other DBs NCBI-GeneID:  110293440 NCBI-ProteinID:  XP_021016921 Ensembl:  MGP_CAROLIEiJ_G0026754 LinkDB All DBs Position 4 AA seq 365 aa AA seqDB search MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQAGSGSWQDQAMQLVT DLETRGRQALPLFISCLEDTGQGTLASVLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLT AKEQRVVKLDXSQPALGNLTPVVLGPEELWPARLKPEVLRPETPRLVDIGSGGAHDVCAP GKIRGHXDMAYTLDSDPCGHCLIINNVNFCPSSGLRTRTGSNVDRDKLEHRFRWLRFMVE VKNDLTAKKMITALMEMGHQDHRALDCFVVVILSHGCQASHLQFLGAVYGTDGCSVSIEK IVNIFNGNGCPSLGGKPKLFFIQACGGDTRLGILTLQLEVTPSPPAHTMLVFTELPHQLA LEQVA NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt atggacgaggcggaccggcagctcctgcggcgatgcagggtgcgcctagtgagcgagctg caagtcgcggagctctgggacgctctgctgagtcgagagctcttcacgcgcgacatgatc gaggatattcagcaggcaggctctgggtcttggcaggatcaggccatgcagctggtcaca gaccttgagacccgagggaggcaggcccttcctctcttcatctcctgcttagaggacaca ggccaaggcaccctggcttcagtcttacaaagcggtcggcaagcagccaagcaggatcca gaggctgttaaacccctagaccacctggtgcctgtggtcctgggaccaatgggactcaca gcaaaggagcagagagttgtgaagctggaccngtcacagcctgccttgggaaacctcacc ccagtggtgctggggccagaagagctctggcctgctcgcctcaagccagaggttctcaga ccagaaacacccaggctggtggacattggttctggcggagctcatgatgtctgtgctcca gggaagatcaggggacatgnagatatggcatacaccctggattcggatccctgtggccac tgcctcatcatcaacaatgtgaacttctgcccttcctcggggctccgcacacgcaccggc tccaacgtggaccgtgacaaacttgagcaccgtttccgctggctgcgcttcatggtggag gtgaagaacgacctgactgccaagaaaatgatcacggctttaatggagatggggcaccag gaccaccgtgccctggactgctttgtggtggtcatcctctctcacggctgccaggccagt cacctccagttcctgggtgctgtctatgggacagatggatgctctgtgtccattgagaaa attgtgaacatcttcaacgggaatggctgccccagcctgggagggaagcccaagctcttc ttcatccaggcctgcggtggtgacacccgactggggatactcacattgcagctggaggtc acgccatcgccaccagcgcacaccatgctggtcttcacagagcttccccaccagctagcg ctggagcaggtggcatag

DBGET integrated database retrieval system