KEGG   Mus caroli (Ryukyu mouse): 110293657
Entry
110293657         CDS       T05910                                 

Gene name
Hes5
Definition
(RefSeq) transcription factor HES-5
  KO
K06055  hairy and enhancer of split 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04330  Notch signaling pathway
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110293657 (Hes5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293657 (Hes5)
  09162 Cancer: specific types
   05224 Breast cancer
    110293657 (Hes5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110293657 (Hes5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110293657 (Hes5)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    110293657 (Hes5)
SSDB
Motif
Pfam: HLH Hairy_orange FancD2
Other DBs
NCBI-GeneID: 110293657
NCBI-ProteinID: XP_021017190
Ensembl: MGP_CAROLIEiJ_G0026879
UniProt: A0A6P5PTH9
LinkDB
Position
4
AA seq 166 aa
MAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAPAAPAKEPPAPGAAPQPARSSAKAAAAVSTSRQPACGLWRPW
NT seq 501 nt   +upstreamnt  +downstreamnt
atggccccaagtaccgtggcggtggagatgctcagtcccaaggagaaaaaccgactgcgg
aagcccgtggtggagaagatgcgtcgggaccgcatcaacagcagcatagagcagctgaag
ctgctgctggagcaggagttcgcgcggcaccagcccaactccaagctggagaaggccgac
atcctggagatggccgtcagctacctgaaacacagcaaagccttcgccgcggccgccggc
cccaagagcctgcaccaggactacagcgagggctactcctggtgcctgcaggaggcggtg
cagttcctgaccctgcacgccgccagcgacacgcagatgaagctgctttaccacttccag
cggcccccagctcccgccgcgcctgccaaggagcccccggcgcccggagctgcgccccaa
ccggcgcgctcctccgctaaggctgctgctgcggtctccacctcccgccaacccgcctgc
ggcctctggcggccctggtga

KEGG   Mus caroli (Ryukyu mouse): 110311640
Entry
110311640         CDS       T05910                                 

Gene name
Hes1
Definition
(RefSeq) transcription factor HES-1
  KO
K06054  hairy and enhancer of split 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03460  Fanconi anemia pathway
mcal04330  Notch signaling pathway
mcal04950  Maturity onset diabetes of the young
mcal05165  Human papillomavirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    110311640 (Hes1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110311640 (Hes1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311640 (Hes1)
  09162 Cancer: specific types
   05224 Breast cancer
    110311640 (Hes1)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    110311640 (Hes1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110311640 (Hes1)
   05165 Human papillomavirus infection
    110311640 (Hes1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110311640 (Hes1)
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110311640 (Hes1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    110311640 (Hes1)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     110311640 (Hes1)
SSDB
Motif
Pfam: Hairy_orange HLH
Other DBs
NCBI-GeneID: 110311640
NCBI-ProteinID: XP_021040736
Ensembl: MGP_CAROLIEiJ_G0020642
UniProt: A0A6P5R0K4
LinkDB
Position
16
AA seq 281 aa
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPAGPQHA
PFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFA
HSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSDSMWRPWRN
NT seq 846 nt   +upstreamnt  +downstreamnt
atgccagctgatataatggagaaaaattcctcctccccggtggctgctaccccagccagt
gtcaacacgacaccggacaaaccaaagacggcctctgagcacagaaagtcatcaaagcct
atcatggagaagaggcgaagggcaagaataaatgaaagtctgagccaactgaaaacactg
attttggatgcacttaagaaagatagctcccggcattccaagctagagaaggcagacatt
ctggaaatgacagtgaagcacctccggaacctgcagcgggcgcagatgaccgccgcgctc
agcacagacccgagcgtgttggggaaataccgcgccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgtgagggcgttaacaccgaggtgcgcactcggctgctg
ggccacctggccaactgcatgacccagatcaacgccatgacctaccccgggcaggcgcac
cccgccttgcaggcgccgccgccgccgcccccgtcaggncctgccggtccccagcacgcg
ccattcgcgccgccgccgccgcttgtgcccatccccgggggcgcggcgccccctcccggc
agcgcaccctgcaagttgggcagccaggctggagaggctgccaaggtttttggcggcttc
caagtggtgccggctcctgacggccagtttgcctttctcatccccaacggggccttcgct
cacagcggcccggttatcccggtctacaccagcaacagtgggacctcggtgggtcctaac
gcagtgtcaccttccagtggctcctcgctcacttcggactccatgtggagaccgtggcgg
aactga

DBGET integrated database retrieval system