KEGG   Mus caroli (Ryukyu mouse): 110293768
Entry
110293768         CDS       T05910                                 

Gene name
Ubr4
Definition
(RefSeq) E3 ubiquitin-protein ligase UBR4 isoform X1
  KO
K10691  E3 ubiquitin-protein ligase UBR4 [EC:2.3.2.27]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05165  Human papillomavirus infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110293768 (Ubr4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110293768 (Ubr4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110293768 (Ubr4)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110293768 (Ubr4)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    110293768 (Ubr4)
SSDB
Motif
Pfam: E3_UbLigase_R4 zf-UBR Ribosomal_L30 DUF4820
Other DBs
NCBI-GeneID: 110293768
NCBI-ProteinID: XP_021017294
Ensembl: MGP_CAROLIEiJ_G0026713
UniProt: A0A6P5PQ69
LinkDB
Position
4
AA seq 5181 aa
MATSGGEEAAAAAPAPGAPATGQDTTPGWEVAVRPLLSASYSAFEMKELPQLVASVIESE
SEILHHEKQYEPFYSSFVALSTHYITTVCSLIPRNQLQSVAAACKVLIEFSLLRLENPDE
ACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPV
SPELRQKEVQMNFLNQLTSVFNPRTVPSPPVSPQALVEGENDEQSSPDQVSAVRTKSVFI
AQNVASLQELGGSEKLLRVCLNLPYFLRYINRFQDAVVANSFFIMPATVADATAVRNGFH
SLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCLYAGVSVATCMAILHVGSAQQVRT
GSTSSKEDDYESDAATIVQKCLEIYDMIGQAISSSRRAGGEHLQNFQLLGAWCLLNSLFL
ILNLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSPKLGPGKGHQGFGVLSVILANHA
IKLLASLFQDLQVEALHKDWETDGPPAVLSIMAQSTSTQRIQRLIDSVPLTNLLLTLLST
SYRKACVLQRQRKGSMSSDASASTDSNTYYEDDFSSTEEDSSQDDDSEPILGQWFEETIS
PSKEKAAPPPPPPPPPLESSPRVKSPNKQASGEKGNILASRKDPELFLGLASNILNFITT
SMLNSRNNFIRNYLSVSLSEHHMATLASIIKEVDKDGLKGSSDEDFAAALYHFNHSLVTS
DLQSPSLQNTLLQQLGVAPFSEGPWPLYIHPQGLSVLSRLLLIWQHKAGAQGDPDVPECL
KVWDRFLTTMKQNALQGVVPSETEDLNVEHLQLLLLIFHSFSEKGRRAILTMLVQSIQEL
SVNMEVQMRSAPLILARLLLIFDYLLHQYSKAPVYLFEQVQHNLLSPPFGWASGSQDSSS
RRRANTPLYHGFKEVEENWSKHFSSDAAPQPRFYCILSTEASEEDLNRLDSEACEVLFSK
LVKYDELYSSLTTLLAAGSQLDTARRKENKNVTALEACALQYYFLILWRILGILPPSKTY
MNQLAMNSPEMSECDILHTLRWSSRLRISSYVSWIKDHLIKQGMKPEHAGSLVELAASKC
GSVKYDVEIVEEYCARQISSFCSIDCTAVLQLHDIPSLQSIYTLDAAVSKVQVSLDEHFS
KMAAETDPHKSSEITKNLLPATLQLIDTYASFTRAYLLQNLNEEGSTEKPSQEKLHGFAA
VLAIGSSRCKANTLGPTLVQNLPSSVQSVCESWNNINTNEFPNIGSWRNAFANDTIPSES
YISAVQAAHLGTLCGQSLPLAASLKHTLLSLVRLTGDLIVWSDEMNPAQVIRTLLPLLLE
SSTESAAEISSNSLERILGPAESDEFLARVYEKLITGCYNILANHADPNSGLDESILEEC
LQYLEKQLESSQARKAMEEFFSDGGELVQIMMATANEDLSAKFCNRVLKFFTKLFQLTEK
SPNPSLLHLCGSLAQLACVEPVRLQAWLTRMTTSPPKDSDQLEVIQENRQLLQLLTTYIV
RENSQVGEGVCAVLLGTLTPMATDMLANGDGTGFPELMVVMATLASAGQGAGHLQLHNAA
VDWLGRCKKYLSQKNVVEKLNANVMHGKHVMVLECTCHIMSYLADVTNALSQSNGQGPSH
LSVDGEERAIEVDSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCH
TCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTM
KESAFQSEPRVSESLVRHASTSPADKAKVTISDGKVTDEEKPKKSSLCRTVEGCREELQN
QANFSFAPLVLDMLSFLMDAIQTNFQQASAVGSSSRAQQALSELHTVEKGVEMTDQLMVP
TLGSQEGAFENVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGKI
TVLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFS
SSGSVSDHLVLHPQLATGNFIIKAVWLPGSQTELAIVTADFVKIYDLSIDALSPTFYFLL
PSSKIRDVTFLFNEEGKNIIVIMSSAGYMYTQLMEEASSAQQGPFYVTNVLEINHEDLKD
SNSQVAGGGVSVYYSHVLQMLFFSYSQGRSFAATVSRSTLEVLQLFPINIKSSNGGSKTS
PALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPGTFLIQEIKTLPAKAKIQDMVAIRHTA
CNEQQRTTMILLCEDGSLRIYMANVENTSYWLQPSLQPSSVISIMKPVRKRKTATITART
SSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEIS
NNSSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADRKL
SLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSASVSNICPPNLNQSNGTGE
SDSAAPATTSGTVLERLVVSSLEALESCFAVGPIIEKERNKHAAQELATLLLSLPAPASV
QQQSKSLLASLHSSRSAYHSHKDQALLSKAVQCLNTSSKEGKDLDPEVFQRLVITARSIA
VTRPNNLVHFTESKLPQMETEGADEGKEPQKQEGDGCSFITQLVNHFWKLHASKPKNAFL
APACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCPDPAVSFSCKQALI
RVLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSGIPDGGHIRQESQEQSEV
DHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPMLDIPPDADDETMVELAIAL
SLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTASAPASDDEGSTAATDGSTL
RTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEGHPAGPGSVSSSTGAIST
ATGHQEGDGSEGEGEGEAEGDVHTSNRLHMVRLMLLERLLQTLPQLRNVGGVRAIPYMQV
ILMLTTDLDGEDEKDKGALDNLLAQLIAELGMDKKDVSKKNERSALNEVHLVVMRLLSVF
MSRTKSGSKSSICESSSLISSATAAALLSSGAVDYCLHVLKSLLDYWRSQQSDEEPVAAS
QLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKIADTSSRIP
PPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKK
LLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLY
FLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAALAASTGSSSVASSSAPPAASSGQATTQ
SKSSTKKSKKEEKEKEKEGESSGSQEDQLCTALVNQLNRFADKETLIQFLRCFLLESNSS
SVRWQAHCLTLHIYRNSNKAQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTAQT
EKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPEVPF
CYIKLSSIKVDTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAI
VELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPR
CSASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA
VDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLLCKVNEAAPEKPQEDSGTA
GGISSTSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKS
SRTSVQPTFTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVS
QGLIRELFDYNLRRGAAAIREEVRQLMCLLTRDNAEATQQMNDLIIGKVSTALKGHWANP
DLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFLMAVNIKTPVVVENITLMCLRILQK
LIKPPAPTSKKNKDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYEAWKKCLPIRGVDG
NGKSPSKSELHRLYLTEKYVWRWKQFLSRRGKRTTPLDLKLGHNNWLRQVLFTPATQAAR
QAACTIVEALATVPSRKQQVLDLLTSYLDELSVAGECAAEYLALYQKLIASCHWKVYLAA
RGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTGLLSSFVEVESIKRHFKSRL
VGTVLNGYLCLRKLVLQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNL
DDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPL
MRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWCATNEGEPMRIVY
RMRGLLGDATEEFIESLDSTTDEEEDEEEVYRMAGVMAQCGGLQCMLNRLAGVKDFKQGR
HLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESKDSGGAAVAEQV
LSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIPY
LSFGEVEKMQILVERFKPYCSFEKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLI
LQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAMQHPATQVLIGT
DSITSLHKLEQVSSDEGIGTLAENLLEALREHPDVNKKIDAARRETRAEKKRMAMAMRQK
ALGTLGMTTNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYTFTKRV
ALEEMENKPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPV
WGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGG
RESNIHLIPYIIHTVLYVLNTTRATSREEKNLQGFLEQPKEKWTESAFDVDGPHYFTILA
LHVLPPEQWKAIRVEILRRLLVASHARAVAPGGATRLTDKAVKDYSAYRSSLLFWALVDL
IYNMFKKVPTSNTEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDVA
GLLSEITDPESFLKDLLNSVP
NT seq 15546 nt   +upstreamnt  +downstreamnt
atggcgacgagcggcggcgaagaggcggcggcagcagctccagcgcccggagccccggcg
accgggcaggacacgaccccgggctgggaggtggctgtgcggcccctcctgtccgcgtcc
tactccgccttcgagatgaaggagttgccgcagctggtggcctcagtcatcgagagtgag
tcagaaatcctgcaccatgagaagcagtatgagccgttctactcctcctttgtcgcactg
tccacgcactacatcaccacggtctgcagcctcattccccggaaccagcttcagtcggtg
gcagctgcctgtaaagttctcattgagttttccctcctgcgtctggagaacccggacgag
gcatgtgctgtatcccagaaacacttgattctgctgataaaaggcctgtgcactggctgt
agccgactagacagaacagagattatcacctttacagcaatgatgaagtccgccaagctt
ccacagacagtgaagacgctttcagacgtggaagatcagaaagagctggcctctccagta
agccccgagctaaggcagaaggaggtacagatgaactttttgaaccagctgacctcagtt
tttaaccctagaactgtaccatctcctcccgtcagtccacaggctctggtggaaggagaa
aatgatgagcagtcatctccagatcaggtctctgctgtcaggaccaagagtgtgttcata
gctcagaatgtggctagccttcaagagcttgggggttccgagaagctactccgagtatgc
ctgaacctgccctatttcctgcgctacatcaatcggtttcaggatgctgtggtggccaat
tccttcttcatcatgcctgcaacagtagctgatgccaccgctgttcgaaatggttttcac
tcactggtgattgatgtcaccatggccttggataccctttcccttcctgtgctggaaccc
ctcaatccttctcgtctgcaagatgtgacagtgctcagcctcagctgtctgtatgcaggt
gtgagtgtagccacgtgtatggccattcttcatgtgggtagtgcccagcaagtgcggaca
gggtccacaagctccaaagaagacgactacgaaagtgatgcagccacgattgttcagaaa
tgtcttgagatctacgacatgattggacaggccatcagcagctcccgccgcgcaggtggt
gagcacttgcagaacttccagctgctgggcgcctggtgcctgcttaacagcctcttcctc
atactgaacctcagccccacagccctggctgacaaggggaaagagaaggacccgttggct
gcccttcgagtcagagacatcctttctcgtacaaaggagggagtgggctctcccaaactg
gggcctggcaaagggcatcaaggatttggggtactctcggtgatactggcaaaccatgcc
atcaagctgctggcatctctctttcaagacctgcaggtggaggcactccacaaggactgg
gagacagacggcccccctgcagtcctgagtattatggcccagagcacctccacacaaagg
attcaacggctgattgactctgtcccgctgacaaacctgcttttgactttactttcaact
tcatacagaaaggcgtgtgtcctgcagcggcagaggaagggctccatgagcagtgatgcc
agcgcctccaccgactccaacacgtactatgaggatgacttcagtagcacagaggaagat
agcagccaagatgatgacagtgagcctattttggggcagtggtttgaggagaccatctct
cccagtaaagaaaaagctgcgcctccacctcctccaccaccccctcccctggagagctct
cctcgggttaaaagccccaataaacaggcatctggtgagaagggcaacatcttggccagt
cgcaaagatcctgagttgttcttaggtctggcttccaacatcctgaactttatcacgact
tccatgctgaactctcgaaacaatttcatccggaactatctgagcgtctctctttcagag
caccacatggccactctggccagcatcattaaggaggtggacaaagatggactcaagggg
tcatcagatgaggactttgctgctgctctctatcacttcaaccactcgctggtgacttct
gacctacagtccccgagcctgcagaacacactgctccagcagctgggagttgctcctttc
tccgaaggcccttggcccctgtacattcacccccaaggcctctctgtgctttctcgcctc
ctgcttatctggcagcataaagctggagcacaaggtgaccctgatgtccctgaatgcctg
aaagtgtgggacaggtttttaactaccatgaagcagaacgcactgcagggggtggtgccc
agtgagacagaagacctgaacgttgagcacctgcagctgctgctgctcatcttccacagc
ttctctgagaagggccgcagagccatcttgaccatgcttgtgcagagcatccaggagctg
agtgttaacatggaggtgcagatgcgctctgcaccgctgatcctggcccgcctcctcttg
atcttcgactacctacttcatcagtactccaaagcccctgtgtatctgtttgagcaggtg
cagcacaacctgctaagtcccccttttgggtgggcaagtggatcccaagacagcagcagc
cgccgccgagccaacactcctctgtatcatggcttcaaggaagtagaagaaaattggtcc
aaacatttttcatcagatgcggccccacaacccaggttctactgcatcctgtccacagag
gcctccgaggaggatttgaaccggctggattctgaggcatgtgaagttcttttctccaag
cttgtcaagtacgatgaactttattcctcactgactaccctgcttgcggctggatctcag
cttgatacagccagaaggaaggaaaataagaacgtgacagccctggaggcctgcgccctg
cagtattacttcttgattctctggaggatcttaggaattttgccaccttcaaagacttac
atgaaccagctggccatgaactcacctgagatgagtgaatgtgacatcttacacactctg
cgatggtcgtctcgcctccggatcagttcctatgtcagctggataaaggatcaccttatc
aaacaaggcatgaagcccgagcatgcgggctctcttgtagagctggctgccagcaagtgt
ggctcagtgaagtacgatgttgagattgtagaggagtactgtgcccgacagatctcgtcc
ttctgctccattgactgcactgccgtcctccagttgcatgacattcctagtctgcagtcc
atctacaccctggatgctgctgtctcgaaggtccaggtctctctggatgagcacttttct
aagatggccgcagagaccgatccccataagtcatctgagatcaccaagaacctccttcca
gctacgctgcagctcattgacacctatgcctcattcaccagagcctatctgctgcagaac
cttaatgaagagggatccactgagaagccctcacaggagaagctacacggctttgcagct
gtcttggctatcggctctagtaggtgcaaggcaaacacactgggaccaactctagtgcag
aatttaccgtcatcagtgcagtctgtctgtgagtcctggaataacatcaataccaatgag
tttcccaacattggatcctggcgcaatgcatttgccaacgacaccatcccgtctgagagt
tacatcagtgctgtgcaggctgctcacctggggactctgtgtggccagagtctgcccctg
gcggcttccctgaaacataccctcctctccctggtcaggttgactggggatctgattgtg
tggtcagatgagatgaacccagcacaggtcatccggactctgctaccgcttctcttggag
tcaagcacagagagcgctgctgagatcagcagtaactctctggaacgcatcttgggaccc
gcggagtctgatgagttcctggctcgtgtgtatgagaagctgatcacgggatgttacaac
attctggccaaccatgcagatcccaacagtgggctggacgagtccatcctggaggagtgt
ttacagtatctggagaagcagctggagagcagccaggcccggaaggccatggaggagttc
ttctctgatggtggggagctggtgcagatcatgatggccacagccaatgaggacctctct
gctaaattctgtaaccgagtcttgaaattcttcaccaaactcttccagctgactgagaag
agccctaacccaagcctccttcacctctgtggctctctcgcccagcttgcgtgtgtggag
ccggtacgccttcaggcctggctcacccgcatgacaacatcgcccccgaaggattctgac
cagctggaggtcattcaggagaaccggcagctgctgcagttactgaccacgtacatcgtt
cgggagaacagccaagttggagaaggtgtgtgtgctgtgcttctgggcaccctgaccccc
atggcaacagatatgctggcgaacggtgatgggaccggcttccctgagctcatggttgtg
atggccactctagccagtgccgggcaaggagctggccaccttcagcttcacaatgctgca
gtggactggctgggcagatgcaagaaatacctgtcacagaagaatgtggtcgagaagctc
aatgccaatgtaatgcatggaaagcatgtgatggtcttggagtgcacatgtcatattatg
tcttacctggctgatgtcacaaatgccctgagccagagtaatggtcaaggcccaagccat
ctgtcagtggatggggaagagcgtgccattgaggtggattcagactgggtggaagagtta
gcggtggaggaggaagactcccaggctgaggactctgatgaagattctctttgcaacaag
ctgtgtaccttcaccatcacacagaaggagtttatgaaccagcattggtaccactgtcat
acctgtaagatggtggatggggtgggtgtgtgcacagtgtgtgcgaaggtatgccataag
gaccatgagatttcctacgccaagtatggctcctttttctgtgactgtggagccaaggaa
gatggcagctgtttggcactggtgaagcgaactcctagcagtggcatgagctctaccatg
aaggagtcagcgtttcagagcgaacctagggtttccgaaagtctggtgcgccatgccagc
acctctcctgctgacaaggccaaggtcaccatcagtgatggcaaggttacagatgaagag
aagcccaagaagagcagcctgtgccgtacagttgaggggtgtcgtgaggagctgcagaat
caggccaatttctccttcgctcctctcgtgttagacatgctcagtttcctcatggatgcc
attcagaccaactttcagcaggcttcagccgtggggagcagcagcagggcccagcaggcc
ctcagtgaactgcacacagtggaaaagggtgtggagatgacggaccagctgatggttccc
accttaggctcacaggaaggtgcctttgagaatgttcggatgaattacagtggagaccag
ggccagactatacggcagctgatcagtgcccacgtgctcagacgggtggctatgtgtgtg
ctttcttccccccatgggcgccgccagcatttggctgttagccacgagaagggcaagatc
acagtgctgcagctctcagcgctcctgaagcaagcagattccagtaagaggaagctgacg
ctaacccgcttggcttctgccccagttcccttcacagtgctgagtcttactggaaacccc
tgcaaggaggactacctggcagtgtgtgggctgaaggactgccacgtgctcaccttcagc
agctcaggctctgtctccgatcacttagtgttacatccccagttggccacagggaacttc
atcatcaaagctgtgtggctccctggttcacagactgagctagccatcgtcaccgcagac
ttcgtcaagatttacgacctgtctattgatgccttgagtccaaccttctacttcctcctg
ccgagctcaaagataagagacgttaccttccttttcaacgaggaaggcaagaacatcatt
gtcatcatgtcctctgctgggtacatgtacacacagctcatggaggaggccagcagtgcc
cagcagggccccttctatgtcactaatgtgctggaaataaatcacgaggacctgaaggac
agtaacagccaggtggcaggcggtggcgtgtctgtgtactattcacacgtgttgcagatg
cttttcttcagctacagtcagggcaggtcctttgcagccactgtgagcaggagcaccctg
gaggtgttgcagctcttccccatcaacatcaaaagctccaatggtggcagtaagacttct
cctgccctttgccagtggtccgaggtgatgaaccaccctggcttggtgtgttgtgttcag
cagactactggcgtgcctctggtggtcatggtgaagccaggcactttcctcatccaggag
attaagactcttcccgccaaagcaaagatccaagacatggttgccattaggcacactgcc
tgcaatgagcagcagcgtacaaccatgatcctgctgtgcgaggacggcagcctgcggatt
tacatggccaatgtagagaacacctcttactggctccagccgtctctgcagcccagcagt
gtcatcagcatcatgaaacctgtgcggaagcgcaaaacagctaccatcacagcccgcaca
tccagccaggtcaccttccccattgacttttttgaacataaccagcagctaacagatgtg
gagtttggcggtaatgacctcttgcaagtctacaatgcacagcagataaagcacaggctg
aactccactggcatgtacgtggctaacaccaagcctggcggcttcaccatcgagatcagt
aacaacagcagcactatggtgatgacgggcatgcggatccagattgggacacaggccatc
gagcgggctccgtcctacatcgagatcttcggcaggaccatgcagctgaacctgagccgc
tcccgctggtttgacttccccttcaccagagaggaggccctgcaggccgaccggaagctg
agcctcttcatcggtgcctccgtggatccagctggtgtcaccatgatagatgctgtaaaa
atttatggcaagactaaagagcagtttggctggcctgatgagcccccagaagacttccct
tctgcctcagtcagcaacatctgccctcctaacctgaaccagagcaatggcactggagag
agtgactcagccgctcccgccacaaccagtggcactgtcctggagaggctggttgtgagt
tctttggaagccctggaaagctgctttgctgttggcccaatcattgagaaggagagaaac
aagcatgctgctcaggagctagccactttgttgctctccctgccagcgcctgccagtgtc
cagcagcaatcaaagagcctcctggccagtctgcacagcagccgttcggcctaccacagc
cataaggaccaggccttgttgagcaaagctgtgcagtgtctcaacacatccagcaaagaa
ggcaaggacttggaccccgaggtgttccagcgcctggtgatcacagctcgctccattgcc
gtcacacgccctaacaaccttgtgcacttcacggagtcaaagctgccccagatggaaaca
gaaggagcagatgaggggaaagagccacagaagcaggaaggagacggctgtagtttcatc
actcagcttgtaaaccacttctggaaactccatgcatctaagcccaagaatgccttcctg
gcacctgcctgcctgccaggccttactcatatcgaagctacggttaatgcgttggtagac
attatccatggttattgtacctgcgagctggactgtatcaacacagcatccaagatctac
atgcagatgctgctgtgtcctgaccctgctgtgagcttctcctgtaaacaagctctgatt
cgagtcctaaggcccaggaacaagcggagacacgtgacattgccctcctcccctcgaagc
aacactccaatgggagacaaggacgatgatgatgacgatgatgctgatgagaaaatgcag
tcatcgggcatccccgatggtggtcacatccgccaggaaagccaggaacagagtgaggtg
gaccatggagattttgagatggtgtctgagtcgatggtcctggaaacagctgaaaatgtc
aacaatggcaacccctctcccctggaggccctgctggcaggtgctgaaggctttcctccc
atgctggacatcccacctgatgcagacgacgagaccatggttgaactagccattgccctg
agcctgcagcaggaccagcaaggcagcagcagcagtgccctgggcctgcagagcctggga
ctctccggccaggcacccagctcttcctctctggacgcaggaaccctctctgacaccaca
gcatcagctccagcctcagatgacgagggcagcactgcagcaactgacggctccaccctg
cggacctcgccagctgaccatggcggtagtgtgggctcagagagcgggggaagtgcagtg
gactcggtggctggcgagcacagtgtgtctggccggagcagtgcatatggtgatgccaca
gctgaggggcacccggctggaccagggagcgtcagctctagcacaggcgccatcagcact
gccactgggcaccaggagggagacggctctgagggagaaggagaaggggaagctgaagga
gatgtgcacactagcaacaggctacacatggttcgtctgatgctgttggaaagattactg
cagacactgccccagttacggaatgtcggaggtgtccgggccatcccgtacatgcaggtc
attctcatgctcactacagatctggatggagaagatgagaaagacaagggagccctggac
aacctgctcgcgcagctcatcgccgagctgggcatggacaaaaaggatgtctccaagaag
aacgagcgcagtgctctgaatgaagtccatttggtcgtgatgagactcctgagtgtcttc
atgtcccgtaccaagtctggatccaaatcttccatctgtgagtcctcttccctcatctcc
agtgccacggcagcagccctgctgagctcaggggctgtggactattgcctccatgtgctc
aagtctctgctggactactggaggagccagcagagtgatgaggagcctgtggccgccagc
cagctgctgaaaccacacacgacttcatctccgccagatatgagcccattctttctccgc
cagtatgtgaagggccatgccgctgatgtctttgaagcctatacccagctgctcacagag
atggtactgaggcttccctaccaaatcaagaagatcgcagacaccagctctcggattcct
cctcctgtctttgatcactcctggttctacttcctctctgagtacctaatgatccagcag
accccttttgtccgccgccaagttcgaaaacttctgctcttcatctgtggatcaaaggag
aagtaccgacagctccgagacctgcacaccctggactcccatgtgcgtgggatcaagaag
ctgctggaggagcagggcatcttcctccgggccagtgtggtcacagccagttccggctcc
gctttgcagtatgacacgctcatcagcctgatggagcatctgaaggcctgtgcagagatt
gctgcccagcgaaccatcaactggcagaagttctgcatcaaagatgactctgtcctgtac
ttcctcctgcaagtgagtttcctggtagatgagggcgtgtcccccgtgctgctgcagctg
ctctcctgtgctctgtgcggcagcaaagtgctcgcagccctggcggcctccacagggtct
tccagtgtggcttcctcctcagcccctcctgcagccagttctggacaagccacaactcag
tccaaatcttccactaaaaagagcaagaaagaagaaaaggaaaaagagaaagagggtgag
agctctggtagccaggaggaccagctgtgcacagctctcgtgaaccagctgaacagattt
gcagacaaggaaactctgatccagtttctgcgctgtttcctgttggagtccaactcgtcc
tcagtgcgctggcaggcccactgcctgacactgcacatctacagaaattccaacaaggct
cagcaggagctcttgctagatctcatgtggtccatctggccggaattgccagcttacggc
cggaaggctgcccaatttgtggacctactgggctatttctccctgaaaactgcacagaca
gagaagaagttgaaggagtattcccagaaggccgtggagatcctgaggactcagaaccac
atcctcaccaatcaccccaactccaacatctacaacaccttgtctggcttagtggagttt
gacggctattacctagagagcgacccctgcctggtgtgtaacaaccctgaggtgccgttt
tgttatatcaagctgtcttccattaaagtggacacacggtacaccaccacccagcaggtt
gtaaagctcattggcagtcacaccatcagcaaggtgacagtgaaaattggggacctgaag
cgaaccaagatggtgcggacgatcaacctgtactacaacaaccgaactgtgcaggccatc
gtggagctgaaaaataagccagctcgctggcacaaagccaagaaagtccagctgacgcct
ggacagacagaagtcaagattgacctgcctctgcccatcgtggcctctaacctgatgatc
gagtttgcagacttctatgagaactaccaggcctccacagagacccttcaatgtcctcgc
tgcagtgcctctgtccccgccaacccaggcgtctgtggcaactgtggagagaatgtatac
cagtgtcacaagtgcaggtccatcaactatgatgaaaaggatcccttcctctgcaatgct
tgtggcttctgtaaatacgcccgctttgacttcatgctttacgctaagccttgctgcgca
gtggatcccatcgagaacgaagaagatcggaagaaggccgtttccaacatcaacacactt
ctggacaaagctgaccgcgtgtaccatcagctcatgggacatcggccccagttggagaac
ctgctctgcaaagtgaatgaagcagctccagaaaagccacaggaagactcaggaacagcg
ggaggcatcagctccacttcagccagtgtgaatcgctacatcctgcagctggctcaagag
tattgtggagactgtaagaactcgttcgatgagctctccaaaatcatccagaaagttttt
gcttcacgcaaagagctgttggaatatgatctacagcaaagagaagcagccaccaagtca
tcccggacgtccgtccagcccacatttactgccagccagtaccgtgctttgtctgtctta
ggctgtggccacacctcctccaccaagtgctatggctgtgcctcagctgtcacagagcat
tgtatcacactactgagggccctggccaccaatccagccctgcggcacatcctcgtctcc
cagggcctcatccgagagctcttcgattacaacctccgccgtggcgctgcagccattcga
gaggaggtccgccagctcatgtgcctcctcaccagagacaacgcagaggccacccagcaa
atgaacgacctgatcattggcaaagtctccactgcactgaagggccactgggctaatcct
gacctggctagcagccttcagtacgagatgctgctgctgacagattccatctccaaggag
gacagctgctgggagctccgcttacgatgtgcactcagccttttcctcatggctgtgaac
atcaaaacgccagtggttgttgagaatatcacactcatgtgtctgcggatcttacagaag
ctgattaaaccacctgccccaaccagcaagaagaacaaggatgtccccgtggaggccctc
accacggtgaaaccgtactgcaatgagatccatgcccaggctcagctgtggctcaagaga
gatcccaaggcatcatatgaagcctggaagaagtgcctgcctatccgaggggtggatggc
aatgggaaatcccccagcaagtcagagctccaccgtctctacttgaccgagaagtacgtg
tggaggtggaaacagttcctgagccggcgggggaagaggaccaccccacttgacctcaag
ctgggccacaacaactggctgcggcaggtactctttaccccagcaacacaggcagcacgg
caggcagcctgtaccatcgtggaagctcttgctactgtccccagccgcaagcagcaggtc
cttgacctcctcaccagttacctggacgagctcagcgttgcgggggagtgtgctgcagag
tacctggctctctaccagaagctcatcgcctcgtgccactggaaggtctacctagctgcg
cgtggagtcctgccctacgtgggcaacctcatcaccaaggaaatcgcccgcctgctggcc
ttggaggaggccacactgagcacagacctgcagcagggatatgccctcaagagtctcaca
ggccttctctcctcctttgtagaggtggaatccattaagaggcattttaagagccgctta
gtgggcactgtgctgaatgggtacctgtgcttgcggaagctagtgctgcagaggaccaag
ctcatcgacgagacccaggacatgctgctggagatgctggaggacatgaccacaggtaca
gagtctgaaaccaaggccttcatggctgtgtgcattgagacagcaaagcgctacaatctg
gatgactaccggactcctgtgttcatctttgagaggctgtgcagcatcatctaccctgag
gagaatgaagtcacggagttctttgtgaccctggagaaggacccccagcaagaggacttt
ctacagggcaggatgcccggaaacccatatagcagcaatgaacccggcattgggcctctt
atgagggacataaagaacaagatctgccaggactgtgacctagtggctcttctggaggat
gacagtgggatggagctcctggtgaacaataaaattatcagtctggaccttcccgtggct
gaggtttacaagaaggtgtggtgtgcgaccaatgagggagagcccatgaggattgtttat
cgaatgcgggggctcctgggcgatgccactgaggagtttatcgagtccctggactccacc
acagatgaagaagaagacgaagaggaggtgtacagaatggccggtgtgatggcccagtgt
gggggtctgcagtgcatgctgaacagactggcaggagtcaaagattttaagcagggacgc
caccttctaacagtgctgctgaagctctttagttactgtgtgaaggtcaaagtcaaccgg
cagcagctggtcaagctggagatgaacactctgaatgtcatgctggggactctaaacttg
gctctggtagctgagcaagagagcaaggacagtggaggagcagctgtggctgagcaggtg
ctaagcatcatggagatcattctagatgaatccaacgcagagcccctgagtgaggacaag
ggcaacctcctcctcacaggtgacaaggatcaactggtgatgctcttggaccagatcaac
agcaccttcgttcgatccaaccctagcgtgctacagggcttgctgcgtatcatcccatac
ctgtccttcggagaggtggagaagatgcagatcctggtggaacggttcaagccatactgc
agcttcgagaagtacgatgaagaccatagtggggatgacaaagtcttcctggattgcttc
tgcaaaattgctgctggtatcaagaacaacagcaatggtcatcagctgaaggatctcatc
ctgcagaagggaatcacccagaatgccctggactacatgaaaaagcatatccccagtgcc
aagaatttggatgctgacatctggaaaaagtttttgtctcgtcctgctctgccatttatt
ttgaggcttcttcggggtctggccatgcagcaccctgccacccaggttctgattggaacg
gactccatcacgagcctgcataagctggagcaggtgtccagtgatgagggcattgggacc
ctggctgagaacctgctggaggccctgagagaacatccagatgtgaataagaagattgac
gcagcccgcagagagacccgagcagagaagaagcgcatggccatggccatgaggcagaag
gctctgggaactctgggcatgacgacaaacgaaaagggtcaggtggtgaccaagactgca
ctcctgaagcagatggaggagctgattgaggagccgggactcacgtgctgcatctgcagg
gaggggtacaagttccagcccacgaaggtcttgggcatttatactttcaccaagagggta
gccttggaggagatggagaacaagccccggaagcagcagggctacagcactgtgtcccat
ttcaacattgtgcactacgactgtcacctggctgccgtcaggttggctagaggccgggaa
gagtgggagagtgctgccctgcagaacgccaacacgaagtgcaatgggctccttccggtc
tggggcccccatgtccctgaatcagctttcgccacttgcttagcaaggcacaacacgtac
ctccaggagtgtaccggccagcgggagcccacgtaccagctcaacatccacgacatcaaa
ctgctcttcctgcgcttcgccatggagcaatcattcagtgcagacaccggcgggggcggc
cgtgagagcaacatccacctgatcccatacatcattcacactgtgctttacgtcctgaac
acgacccgagcaacctcccgggaggagaagaacctccaaggcttcctggaacagcccaaa
gagaagtggacagagagtgccttcgatgtagacgggccccactacttcaccatcctagcc
ctgcatgtcctcccccctgaacagtggaaagccattcgagtagagatcctacgcaggctg
ctggtggcctcgcatgcccgggcagtggctccaggaggagccaccaggttgacagacaag
gcggtgaaggactattctgcgtaccgttcttccctgctcttctgggctctcgtcgatctc
atttataacatgtttaagaaggtgcccactagtaacactgagggcggctggtcctgctct
ctggccgagtacatccgccacaatgacatgcccatctacgaagctgccgacaaagccctg
aaaaccttccaggaggagttcatgccagtggagaccttctcagagttcctcgacgtagca
ggtcttctatcagaaatcaccgatccagagagcttcctaaaggacctgttgaactcagtc
ccctga

DBGET integrated database retrieval system