KEGG   Mus caroli (Ryukyu mouse): 110293855
Entry
110293855         CDS       T05910                                 

Gene name
Pxn
Definition
(RefSeq) paxillin isoform X1
  KO
K05760  paxillin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04062  Chemokine signaling pathway
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04670  Leukocyte transendothelial migration
mcal04810  Regulation of actin cytoskeleton
mcal05100  Bacterial invasion of epithelial cells
mcal05135  Yersinia infection
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110293855 (Pxn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110293855 (Pxn)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110293855 (Pxn)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110293855 (Pxn)
   04062 Chemokine signaling pathway
    110293855 (Pxn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110293855 (Pxn)
   05203 Viral carcinogenesis
    110293855 (Pxn)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110293855 (Pxn)
   05100 Bacterial invasion of epithelial cells
    110293855 (Pxn)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110293855 (Pxn)
   05163 Human cytomegalovirus infection
    110293855 (Pxn)
   05165 Human papillomavirus infection
    110293855 (Pxn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110293855 (Pxn)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 LIM domain-containing proteins
  Paxillin family proteins
   110293855 (Pxn)
SSDB
Motif
Pfam: Paxillin LIM VIR_N
Other DBs
NCBI-GeneID: 110293855
NCBI-ProteinID: XP_021017360
Ensembl: MGP_CAROLIEiJ_G0027629
UniProt: A0A6P5PMI0
LinkDB
Position
5
AA seq 591 aa
MDDLDALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TVLDPLDQWQPSGSRYTHQQPPSPLPVYSSSAKNSSASNAQDGVGSLCSRAGEEEHVYSF
PNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQHSPPGFPADEAESSPPLPGALSPL
YGVPENNTPLGGKAGPLVKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSSQQQTRISASSATRELDELMASLSDFKMQGLEQRVDGERPWAAGWPPSSR
QSSPEGQDEGGFMAQGKTGSSSPPGGLSKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYC
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCA
RAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQK
PITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSCFLKLFC
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggacgacctcgatgccctgctggcagacttggaatctaccacttcccacatctccaaa
cggccagtgttcttgtcagaggagcccccctactcctaccccactggaaaccacacatac
caggagatcgcggtgccacctccggtcccaccaccaccgtccagcgaggccctcaatggc
acggtcctggaccctttagatcagtggcagcctagtggttccagatacactcaccagcag
cctccgtccccactacccgtgtacagctccagtgctaaaaattccagtgcctccaacgcc
caggacggcgtgggctccctttgttcccgagcaggcgaggaagagcacgtctacagcttc
cccaacaagcagaagtcggcggagccctcacctaccgtgatgagctcctccttgggcagc
aacctctctgaacttgaccggctgttactggagctgaacgcggtgcagcatagcccgccc
ggcttccctgcagatgaagccgaatcgagcccccccttgcctggagccctgagccccctt
tatggcgtcccagaaaataacactcccttgggtggcaaagcggggcccctggtgaaagag
aagccaaagcgaaatggaggccgggggctagaggatgtgcggcccagcgtggagagcctc
ttggatgaactggagagttccgtgcccagccctgtcccagccatcactgtgaaccaggga
gagatgagcagtccgcaacgagtcacctccagccagcagcagacccggatctcggcctcc
tctgctaccagggagctggacgagctcatggcgtcactgtcagatttcaagatgcagggc
ctggaacagagagtggatggagagcggccgtgggcagccggctggccccccagcagcagg
cagagcagccccgaagggcaggacgagggagggttcatggcccaggggaaaactggaagc
agttcaccccctggggggctctctaagcccgggagccagctggacagcatgttggggagt
ctgcagtctgacctgaacaaactaggggtcgccaccgttgccaaaggggtctgtggagcc
tgcaagaagccaatcgccgggcaggtcgtgaccgccatggggaagacatggcaccctgag
cactttgtgtgcacccactgccaggaagagattggatcccgaaacttttttgagcgggac
ggacagccctactgtgagaaggactaccacagcctcttctccccacgctgctactactgc
aacgggcccatcctggataaagtggtgacagcgctggaccgcacgtggcacccggaacac
ttcttctgtgcccagtgtggagccttctttggtccagaaggctttcacgagaaggacggc
aaagcgtactgtcggaaagattacttcgacatgttcgctcccaagtgcggcggctgcgcc
cgcgccatcctggagaactacatttcagccctcaacaccctctggcaccccgaatgcttt
gtgtgcagggagtgcttcacacccttcgtcaacggcagcttcttcgagcacgacgggcag
ccgtactgtgaggtccactatcacgagcggcgtggctctctgtgctctggctgccagaag
cccatcacgggccgctgcatcaccgccatggccaagaagttccaccctgagcatttcgtg
tgcgccttttgcctgaagcagctcaacaagggcaccttcaaggagcagaacgacaaaccc
tactgccagagctgcttcctgaagctcttctgctag

DBGET integrated database retrieval system