KEGG   Mus caroli (Ryukyu mouse): 110293909
Entry
110293909         CDS       T05910                                 

Gene name
Fgfr3
Definition
(RefSeq) fibroblast growth factor receptor 3
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04144  Endocytosis
mcal04151  PI3K-Akt signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05219  Bladder cancer
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110293909 (Fgfr3)
   04014 Ras signaling pathway
    110293909 (Fgfr3)
   04015 Rap1 signaling pathway
    110293909 (Fgfr3)
   04020 Calcium signaling pathway
    110293909 (Fgfr3)
   04151 PI3K-Akt signaling pathway
    110293909 (Fgfr3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110293909 (Fgfr3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110293909 (Fgfr3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110293909 (Fgfr3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293909 (Fgfr3)
   05206 MicroRNAs in cancer
    110293909 (Fgfr3)
   05230 Central carbon metabolism in cancer
    110293909 (Fgfr3)
  09162 Cancer: specific types
   05219 Bladder cancer
    110293909 (Fgfr3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110293909 (Fgfr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110293909 (Fgfr3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110293909 (Fgfr3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110293909 (Fgfr3)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   110293909 (Fgfr3)
CD molecules [BR:mcal04090]
 Proteins
  110293909 (Fgfr3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM C2-set_2 Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 110293909
NCBI-ProteinID: XP_021017443
Ensembl: MGP_CAROLIEiJ_G0027120
UniProt: A0A6P5PMP8
LinkDB
Position
5
AA seq 802 aa
MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCH
PPGGAPTGPTVWAKDGAGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFS
VRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSI
SWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVL
ERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYV
TVLKSWISENVEADARLRLANVSERDGGEYLCRATNFIGVAEKAFWLRVHGPQAAEEELM
ETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHKVSRFPLKRQVS
LESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFG
QVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGA
CTQGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARG
MEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPE
ALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPASCTHDLY
MIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSG
DDSVFTHDLLPPGPPSNGGPRT
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggtagtcccggcctgcgtgctagtgttctgcgtggcggtcgtggctggagctacttcc
gagcctcctggtccagagcagcgagttgtgcggagagcggcagaggttccagggcctgaa
cctagccagcaggagcaggtggctttcggcagtggggataccgtggagctgagctgccat
cctcctggaggtgcccccacagggcccacggtctgggctaaggatggtgcaggtctggtg
gcctcccaccgcatcctggtggggcctcagaggctgcaagtgctaaatgcctcccacgaa
gatgcaggggtctacagctgccagcaccggctcactcggcgtgtgctgtgccacttcagt
gtgcgtgtgacagatgctccatcctcaggagatgacgaagatggggaggacgtggctgaa
gacacaggggctccttattggactcgcccagagcgaatggataagaaactgctggctgtg
ccagctgcaaacactgtccgcttccgctgcccggctgctggcaaccctaccccctccatc
tcctggctgaagaatggcaaagaattccgaggggagcatcgcattgggggcatcaagctc
cggcaccagcagtggagcttggtcatggaaagtgtggtaccctctgatcgtggcaactat
acctgcgtggttgagaacaagtttggtagcatccggcagacatacacactggatgtgctg
gagcgctccccacaccggcccatcctgcaggctgggctgccggccaaccagacagccatt
ctaggcagtgacgtggagttccactgcaaggtgtacagcgatgcacagccacacatccag
tggctgaagcacgtggaagtgaacggcagcaaggtgggccctgacggcacgccctacgtc
actgtactcaagtcctggatcagtgagaatgtggaggcagacgcacgcctccgcctggcc
aatgtgtcggagcgggacgggggcgagtacctctgtcgagccaccaatttcataggcgtg
gctgagaaggccttttggctgcgtgttcacgggccccaagcagctgaggaggagctgatg
gaaactgatgaggctggcagcgtgtacgcaggcgtcctcagctacggggtggtcttcttc
ctcttcatcctggtggtggcagctgtgatactctgccgcctgcgcagtcccccaaagaag
ggcctgggctcgcccaccgtgcacaaggtctctcgcttcccgcttaagcgacaggtgtcc
ttggaatctaactcctctatgaactccaacacacccctcgtccggattgcccggctgtcc
tcaggagaaggtcccgttctggccaatgtttctgaacttgagctgcctgctgaccccaag
tgggagctatccaggacccggctgacacttggtaagcctcttggagaaggctgctttgga
caggtggtcatggcagaagctattggcatcgacaaggaccgtactgccaagcctgtcacc
gtggccgtgaagatgctgaaagatgatgcgactgacaaggacctgtcggacctggtatct
gagatggagatgatgaaaatgattggcaagcacaagaacatcattaacctgctgggggcg
tgcacacagggtgggcccctgtatgtgctggtggaatacgcagccaagggcaatctccgg
gagttccttcgggcgcgacggcctccaggcatggactactcctttgatgcctgcaggctg
ccagaggaacagctcacctgcaaggatctagtgtcctgtgcctaccaggtggcacggggc
atggaatacttggcttctcagaagtgtattcacagagacttggctgccagaaacgtcctg
gtgactgaggacaatgtgatgaagattgcggactttggcctggctcgagatgtgcacaac
ctggactactacaagaagaccacaaatggccggctacctgtgaagtggatggcaccagag
gccctttttgaccgagtctacacccaccagagtgatgtttggtcttttggtgtcctcctc
tgggagatctttacgctggggggctcaccgtatcctggcatcccagtggaagagcttttc
aagctgttgaaagagggccaccgtatggacaagccagccagctgcacacatgacctgtac
atgatcatgcgggaatgttggcatgcggtaccttcacagaggcccaccttcaagcagttg
gtagaggatttagaccgcatcctcactgtgacatcaactgacgaatacttggacctctcc
gtgccatttgagcagtactcgccaggtggccaggacacgcctagctccagctcatccgga
gatgactcggtgttcacccatgacctgctacccccaggcccacccagtaatgggggacct
cggacgtga

DBGET integrated database retrieval system