KEGG   Mus caroli (Ryukyu mouse): 110293965
Entry
110293965         CDS       T05910                                 

Gene name
Rac1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04145  Phagosome
mcal04151  PI3K-Akt signaling pathway
mcal04310  Wnt signaling pathway
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04530  Tight junction
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04972  Pancreatic secretion
mcal05014  Amyotrophic lateral sclerosis
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05100  Bacterial invasion of epithelial cells
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05231  Choline metabolism in cancer
mcal05416  Viral myocarditis
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110293965 (Rac1)
   04014 Ras signaling pathway
    110293965 (Rac1)
   04015 Rap1 signaling pathway
    110293965 (Rac1)
   04310 Wnt signaling pathway
    110293965 (Rac1)
   04370 VEGF signaling pathway
    110293965 (Rac1)
   04071 Sphingolipid signaling pathway
    110293965 (Rac1)
   04024 cAMP signaling pathway
    110293965 (Rac1)
   04151 PI3K-Akt signaling pathway
    110293965 (Rac1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110293965 (Rac1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110293965 (Rac1)
   04520 Adherens junction
    110293965 (Rac1)
   04530 Tight junction
    110293965 (Rac1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110293965 (Rac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110293965 (Rac1)
   04620 Toll-like receptor signaling pathway
    110293965 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    110293965 (Rac1)
   04662 B cell receptor signaling pathway
    110293965 (Rac1)
   04664 Fc epsilon RI signaling pathway
    110293965 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    110293965 (Rac1)
   04670 Leukocyte transendothelial migration
    110293965 (Rac1)
   04062 Chemokine signaling pathway
    110293965 (Rac1)
  09154 Digestive system
   04972 Pancreatic secretion
    110293965 (Rac1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110293965 (Rac1)
  09158 Development and regeneration
   04360 Axon guidance
    110293965 (Rac1)
   04380 Osteoclast differentiation
    110293965 (Rac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293965 (Rac1)
   05205 Proteoglycans in cancer
    110293965 (Rac1)
   05203 Viral carcinogenesis
    110293965 (Rac1)
   05231 Choline metabolism in cancer
    110293965 (Rac1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110293965 (Rac1)
   05212 Pancreatic cancer
    110293965 (Rac1)
   05211 Renal cell carcinoma
    110293965 (Rac1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110293965 (Rac1)
   05020 Prion disease
    110293965 (Rac1)
   05022 Pathways of neurodegeneration - multiple diseases
    110293965 (Rac1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110293965 (Rac1)
   05416 Viral myocarditis
    110293965 (Rac1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110293965 (Rac1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110293965 (Rac1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110293965 (Rac1)
   05135 Yersinia infection
    110293965 (Rac1)
   05100 Bacterial invasion of epithelial cells
    110293965 (Rac1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110293965 (Rac1)
   05163 Human cytomegalovirus infection
    110293965 (Rac1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110293965 (Rac1)
   05169 Epstein-Barr virus infection
    110293965 (Rac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110293965 (Rac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110293965 (Rac1)
   04031 GTP-binding proteins [BR:mcal04031]
    110293965 (Rac1)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    110293965 (Rac1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    110293965 (Rac1)
  Macropinocytosis
   Ras GTPases
    110293965 (Rac1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    110293965 (Rac1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110293965 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   110293965 (Rac1)
  Exosomal proteins of colorectal cancer cells
   110293965 (Rac1)
  Exosomal proteins of bladder cancer cells
   110293965 (Rac1)
GTP-binding proteins [BR:mcal04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    110293965 (Rac1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 110293965
NCBI-ProteinID: XP_021017540
Ensembl: MGP_CAROLIEiJ_G0027982
UniProt: A0A6P5PPA8
LinkDB
Position
5
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacctgcctgctc
atcagttacacgaccaatgcatttcctggagagtacatccccaccgtctttgacaactat
tccgccaatgttatggtagatgggaaaccagtgaacctgggcctgtgggacacagctgga
caagaagattatgacagactgcgtcccctctcctacccgcagacagatgtgttcttaatt
tgcttttcgcttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaa
gtgcgacaccactgtcccaatactcctatcatcctggtggggacgaagcttgatcttagg
gatgataaggacaccattgagaagctgaaggagaagaagctgactcctatcacctacccg
caggggttagccatggcgaaagagatcggtgctgtcaaatacctggagtgctcagctctc
acacagcgaggactcaagacagtgtttgacgaagctatccgagcggttctctgtccccct
cctgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system