KEGG   Mus caroli (Ryukyu mouse): 110294031
Entry
110294031         CDS       T05910                                 

Gene name
Scarb1
Definition
(RefSeq) scavenger receptor class B member 1 isoform X1
  KO
K13885  scavenger receptor class B, member 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04145  Phagosome
mcal04913  Ovarian steroidogenesis
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04934  Cushing syndrome
mcal04975  Fat digestion and absorption
mcal04976  Bile secretion
mcal04977  Vitamin digestion and absorption
mcal04979  Cholesterol metabolism
mcal05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110294031 (Scarb1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110294031 (Scarb1)
   04925 Aldosterone synthesis and secretion
    110294031 (Scarb1)
   04927 Cortisol synthesis and secretion
    110294031 (Scarb1)
  09154 Digestive system
   04976 Bile secretion
    110294031 (Scarb1)
   04975 Fat digestion and absorption
    110294031 (Scarb1)
   04979 Cholesterol metabolism
    110294031 (Scarb1)
   04977 Vitamin digestion and absorption
    110294031 (Scarb1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110294031 (Scarb1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110294031 (Scarb1)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    110294031 (Scarb1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110294031 (Scarb1)
SSDB
Motif
Pfam: CD36 PorA
Other DBs
NCBI-GeneID: 110294031
NCBI-ProteinID: XP_021017650
Ensembl: MGP_CAROLIEiJ_G0027764
UniProt: A0A6P5PNC7
LinkDB
Position
5
AA seq 521 aa
MGGSSRARWVALGLGALGLLFAALGVVMILMVPSLIKQQVLKNVRIDPSSLSFGMWKEIP
VPFYLSVYFFEVVNPNEVLNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSFVENRSLH
FQPDKSQGSESDYIILPNILVLGGSILMENKPASLKLMMTLGLVTMGQRAFMNRTVGEIL
WGYDDPFVNFLNTYLPDMLPIKGKFGLFVGMNNSNSGVFTVFTGVQNFSRIHLVDKWNGL
SKIDYWHSEQCNMINGTSGQMWAPFMTPESSLEFFSPEACRSMKLTYNESRVFEGIPTYR
FTAPDTLFANGSVYPPNEGFCPCRESGIQNVSTCRFGAPLFLSHPHFYNADPVLSEAVLG
LNPNPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGIGQTGKIEPVVLPLLWFEQSG
AMGGKPLSTFYTQLVLMPQVLHYAQYVLLGLGGLLLLVPIICQLRSQVSRGGHALDSDSA
RVSASLRFLQLALVLPPQSHPAVTFLYKSWKAQDPPRSGLG
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgggcggcagctccagggcgcgctgggtggccttggggttgggcgccctggggctgctg
tttgctgcgctcggcgttgtcatgatcctcatggtgccctcgctcatcaagcagcaggtg
ctcaagaatgtccgcatagacccgagcagcctgtccttcgggatgtggaaggagatccct
gtccctttctacttgtctgtctacttcttcgaagtggtcaacccaaacgaggtcctcaac
ggccagaagccagtagtccgggagcgtggaccctatgtctacagggagttcagacaaaag
gttaacatcaccttcaatgacaacgacaccgtgtccttcgtggagaaccgcagcctccat
ttccagcctgacaagtcgcagggctcagagagtgactacattatactgcctaacatcttg
gtcctggggggctcgatattgatggagaacaagcctgcgagcctgaagttgatgatgacc
ttggggctggtcaccatgggccagcgtgcttttatgaaccgcacggttggtgagatcctg
tggggctatgacgatcccttcgtgaattttctcaacacatacctcccagacatgcttccc
ataaagggcaaatttggcctgtttgttgggatgaacaactcaaattctggggtcttcact
gtcttcacgggcgtccagaatttcagcaggatccatctggtggacaaatggaacggactc
agcaagatcgattattggcattcggaacagtgtaacatgatcaatgggacttccgggcag
atgtgggcacccttcatgacacccgaatcctcgctggaattcttcagcccggaggcatgc
aggtccatgaagctgacctacaacgaatcaagggtgtttgaaggcattcccacgtatcgc
ttcacggcccccgatactctgtttgccaacgggtccgtctacccacccaacgaaggcttc
tgcccatgccgcgagtctggcattcagaatgtcagcacctgcaggtttggtgcgcctctg
tttctctcccacccgcacttttacaacgccgaccctgtgctgtcagaagctgttcttggt
ctgaaccctaacccaaaggagcactccttgttcctagatatccatccggtcactgggatc
cccatgaactgttctgtgaagatgcagctgagcctctacatcaaatctgtcaagggcatc
gggcaaacagggaagatcgagccagtagttctaccgttgttgtggtttgaacagagcgga
gcaatgggtggcaagcccctgagcacgttctacacgcagctggtgctgatgccccaggtt
cttcactacgcgcagtatgtgctgctggggcttggaggtctccttttgctggtgcccatc
atctgccaactgcgcagccaggtaagtaggggcggccacgccttggactcggactcggct
cgggtttcagccagcctccgtttcctgcagctagctcttgttctacctcctcaatcgcac
cctgcagtaacttttctctacaagtcctggaaggcccaggaccctcccaggtcggggcta
ggatga

DBGET integrated database retrieval system