KEGG   Mus caroli (Ryukyu mouse): 110294055
Entry
110294055         CDS       T05910                                 

Gene name
Ptpn11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04360  Axon guidance
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04931  Insulin resistance
mcal05168  Herpes simplex virus 1 infection
mcal05205  Proteoglycans in cancer
mcal05211  Renal cell carcinoma
mcal05220  Chronic myeloid leukemia
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110294055 (Ptpn11)
   04630 JAK-STAT signaling pathway
    110294055 (Ptpn11)
   04072 Phospholipase D signaling pathway
    110294055 (Ptpn11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110294055 (Ptpn11)
   04650 Natural killer cell mediated cytotoxicity
    110294055 (Ptpn11)
   04670 Leukocyte transendothelial migration
    110294055 (Ptpn11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110294055 (Ptpn11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110294055 (Ptpn11)
  09158 Development and regeneration
   04360 Axon guidance
    110294055 (Ptpn11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110294055 (Ptpn11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110294055 (Ptpn11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110294055 (Ptpn11)
   05211 Renal cell carcinoma
    110294055 (Ptpn11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110294055 (Ptpn11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110294055 (Ptpn11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110294055 (Ptpn11)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     110294055 (Ptpn11)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    110294055 (Ptpn11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase Tab2_like
Other DBs
NCBI-GeneID: 110294055
NCBI-ProteinID: XP_021017711
Ensembl: MGP_CAROLIEiJ_G0027677
UniProt: A0A6P5PPM3
LinkDB
Position
5
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLVDQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcaccccaacatcactggtgtggaggcagagaatctcctg
ctgaccagaggagtcgatggcagttttttagcaaggcccagtaagagtaaccctggagac
ttcactctgtctgttagaagaaatggagctgttacccacatcaagattcagaacactggg
gactactatgacctctatggtggggagaagtttgccaccttggctgaactggtccagtat
tacatggaacaccatgggcagctgaaagagaagaatggagatgttatcgagctcaagtac
ccgctgaactgtgcagaccctacctctgaaaggtggttccatggtcacttgtctggaaaa
gaagcagagaagctgctgacggagaagggcaagcatggcagcttcctcgttcgagagagc
cagagccaccccggagacttcgttctctctgtgcgcactggtgatgacaaaggggagagc
aacgacggcaagtccaaagtgacccacgtcatgatccgctgtcaggagctgaaatacgac
gttggtgggggagagcgctttgactctcttacagacctggtggagcattacaagaagaac
cccatggtggaaacgctgggcacagtcctgcagctcaagcagcccctcaacacaacccgt
atcaatgctgctgaaattgaaagccgggttcgagagttaagcaagctggctgagaccaca
gataaagtcaagcagggcttttgggaagagtttgagacactccagcaacaggaatgcaaa
cttctctacagccgaaaagaaggacagagacaagaaaataaaaacaaaaacagatacaaa
aacatcctgccctttgatcataccagggtcgttctgcacgatggggatcctaacgagcct
gtttctgattacatcaatgcaaacatcatcatgcctgagtttgagaccaagtgcaacaat
tccaaacccaaaaagagttacattgccactcaaggctgcctgcagaacacggtgaatgac
ttctggcggatggtgttccaggagaactctcgagtcattgtcatgaccacaaaggaagtg
gagagagggaagagcaaatgtgtcaagtactggcctgatgagtatgcactcaaagaatac
ggggtcatgcgtgttaggaacgtcaaagaaagtgccgcccatgactacactttacgagag
ctcaaactctccaaggtcggacaagctctactccagggaaacacagagagaaccgtctgg
cagtaccactttcggacctggccagaccatggcgtgcctagtgaccctggaggtgtgctg
gacttcctggaggaggtccaccacaagcaggagagcatcgtggatgcaggccctgtcgtg
gttcactgcagtgctgggattggccggacaggaacgttcattgtgattgatatccttatt
gacatcattcgagagaaaggtgtggactgtgacatcgacgttcctaaaaccattcagatg
gtgcggtcccagaggtcagggatggtccagacagaagcacagtaccggtttatctacatg
gctgtccagcattacatagagacactgcagcgccggatcgaggaggagcagaaaagcaaa
aggaaaggacatgaatataccaatattaagtattccttggtggaccagacaagtggtgat
cagagtcccctgccaccctgcaccccaacaccaccctgtgcagaaatgagggaggacagt
gcccgagtctatgagaatgtgggcctcatgcagcagcagaggagtttcagatga

DBGET integrated database retrieval system