KEGG   Mus caroli (Ryukyu mouse): 110294148
Entry
110294148         CDS       T05910                                 

Gene name
Mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04024  cAMP signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04137  Mitophagy - animal
mcal04140  Autophagy - animal
mcal04141  Protein processing in endoplasmic reticulum
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04310  Wnt signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04530  Tight junction
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04728  Dopaminergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04917  Prolactin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04926  Relaxin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05162  Measles
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05231  Choline metabolism in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110294148 (Mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110294148 (Mapk10)
   04012 ErbB signaling pathway
    110294148 (Mapk10)
   04014 Ras signaling pathway
    110294148 (Mapk10)
   04310 Wnt signaling pathway
    110294148 (Mapk10)
   04668 TNF signaling pathway
    110294148 (Mapk10)
   04068 FoxO signaling pathway
    110294148 (Mapk10)
   04071 Sphingolipid signaling pathway
    110294148 (Mapk10)
   04024 cAMP signaling pathway
    110294148 (Mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110294148 (Mapk10)
   04137 Mitophagy - animal
    110294148 (Mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    110294148 (Mapk10)
   04215 Apoptosis - multiple species
    110294148 (Mapk10)
   04217 Necroptosis
    110294148 (Mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110294148 (Mapk10)
   04530 Tight junction
    110294148 (Mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110294148 (Mapk10)
   04621 NOD-like receptor signaling pathway
    110294148 (Mapk10)
   04622 RIG-I-like receptor signaling pathway
    110294148 (Mapk10)
   04625 C-type lectin receptor signaling pathway
    110294148 (Mapk10)
   04660 T cell receptor signaling pathway
    110294148 (Mapk10)
   04658 Th1 and Th2 cell differentiation
    110294148 (Mapk10)
   04659 Th17 cell differentiation
    110294148 (Mapk10)
   04657 IL-17 signaling pathway
    110294148 (Mapk10)
   04664 Fc epsilon RI signaling pathway
    110294148 (Mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110294148 (Mapk10)
   04920 Adipocytokine signaling pathway
    110294148 (Mapk10)
   04912 GnRH signaling pathway
    110294148 (Mapk10)
   04914 Progesterone-mediated oocyte maturation
    110294148 (Mapk10)
   04917 Prolactin signaling pathway
    110294148 (Mapk10)
   04926 Relaxin signaling pathway
    110294148 (Mapk10)
   04935 Growth hormone synthesis, secretion and action
    110294148 (Mapk10)
  09156 Nervous system
   04728 Dopaminergic synapse
    110294148 (Mapk10)
   04723 Retrograde endocannabinoid signaling
    110294148 (Mapk10)
   04722 Neurotrophin signaling pathway
    110294148 (Mapk10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110294148 (Mapk10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110294148 (Mapk10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294148 (Mapk10)
   05231 Choline metabolism in cancer
    110294148 (Mapk10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110294148 (Mapk10)
   05212 Pancreatic cancer
    110294148 (Mapk10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110294148 (Mapk10)
   05012 Parkinson disease
    110294148 (Mapk10)
   05016 Huntington disease
    110294148 (Mapk10)
   05017 Spinocerebellar ataxia
    110294148 (Mapk10)
   05020 Prion disease
    110294148 (Mapk10)
   05022 Pathways of neurodegeneration - multiple diseases
    110294148 (Mapk10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110294148 (Mapk10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110294148 (Mapk10)
   04932 Non-alcoholic fatty liver disease
    110294148 (Mapk10)
   04931 Insulin resistance
    110294148 (Mapk10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110294148 (Mapk10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110294148 (Mapk10)
   05135 Yersinia infection
    110294148 (Mapk10)
   05133 Pertussis
    110294148 (Mapk10)
   05152 Tuberculosis
    110294148 (Mapk10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110294148 (Mapk10)
   05170 Human immunodeficiency virus 1 infection
    110294148 (Mapk10)
   05161 Hepatitis B
    110294148 (Mapk10)
   05171 Coronavirus disease - COVID-19
    110294148 (Mapk10)
   05162 Measles
    110294148 (Mapk10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110294148 (Mapk10)
   05169 Epstein-Barr virus infection
    110294148 (Mapk10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110294148 (Mapk10)
   05142 Chagas disease
    110294148 (Mapk10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110294148 (Mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110294148 (Mapk10)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110294148 (Mapk10)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110294148 (Mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Kinase-like APH FTA2
Other DBs
NCBI-GeneID: 110294148
NCBI-ProteinID: XP_021017813
Ensembl: MGP_CAROLIEiJ_G0027465
LinkDB
Position
5
AA seq 494 aa
MGDTGVSGATMKEMAQVMRMAEVTEDGRVFMSLHFLYYCSEPTLDVKIAFCQGFDKHVDV
SSIAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNV
AIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMD
ANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL
ARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYID
QWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKAS
QARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEW
KELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTD
SSLEASAGPLGCCR
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgggagatacaggggtttccggagccaccatgaaggagatggctcaggtgatgagaatg
gctgaagtcactgaggatggcagggtatttatgagcctccatttcttatactactgcagt
gaaccaaccttggatgtgaaaattgccttttgtcagggattcgataaacacgtggatgtg
tcatctattgccaaacattacaacatgagcaaaagcaaggtggacaaccagttctacagt
gtggaagtgggggactcaaccttcaccgttcttaagcgctaccagaacctgaagccaatt
ggctctggggctcagggaatagtttgtgctgcgtatgacgctgtcctcgacagaaatgtg
gccattaagaagctcagcagacccttccagaaccaaactcacgccaagagggcttaccgg
gagctggtcctcatgaagtgtgtgaaccataaaaacattattagcttattaaatgttttt
acaccccagaaaacactggaggagttccaagatgtctacttagtgatggaactgatggac
gccaacttgtgtcaggtgattcagatggagctggaccacgagcggatgtcttacttgctg
taccagatgctgtgtggcatcaagcatctccactccgctgggatcatccacagggactta
aaacccagtaacattgtagtcaagtctgattgcacactgaaaatcctcgacttcggactg
gccaggacagcgggtacaagcttcatgatgactccgtatgtggtgacgcgatattacaga
gcccctgaggtcatcctgggcatgggctacaaggagaacgtggacatatggtctgtggga
tgcatcatgggagaaatggttcgccacaaaatcctctttcccggaagggactatattgac
cagtggaacaaagtcatcgagcagctaggaactccgtgtccagagttcatgaagaaattg
cagcccacagtcagaaactatgtggagaatcggcccaagtacgcaggactcaccttcccc
aagctctttccagattccctcttcccagcggattctgagcacaataaacttaaagccagc
caagccagggatttgttgtctaagatgttagtgattgacccagcgaagaggatatcggtg
gacgacgcactgcagcatccgtacatcaacgtttggtacgacccggctgaagtggaggcg
cctccgcctcaaatatatgataagcagctggatgaaagagagcacaccatcgaagaatgg
aaagaacttatctacaaggaggtaatgaactcagaagagaagactaagaacggcgtagtc
aaaggccagccctcaccttcaggtgcagcagtgaacagcagtgagagtctccctccatcc
tcgtctgtcaacgacatctcctccatgtccaccgaccagaccctcgcatctgacactgac
agcagcctggaggcctcggcgggaccgttgggttgttgcaggtga

KEGG   Mus caroli (Ryukyu mouse): 110304169
Entry
110304169         CDS       T05910                                 

Gene name
Mapk9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04024  cAMP signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04137  Mitophagy - animal
mcal04140  Autophagy - animal
mcal04141  Protein processing in endoplasmic reticulum
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04310  Wnt signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04530  Tight junction
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04728  Dopaminergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04917  Prolactin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04926  Relaxin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05162  Measles
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05231  Choline metabolism in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110304169 (Mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110304169 (Mapk9)
   04012 ErbB signaling pathway
    110304169 (Mapk9)
   04014 Ras signaling pathway
    110304169 (Mapk9)
   04310 Wnt signaling pathway
    110304169 (Mapk9)
   04668 TNF signaling pathway
    110304169 (Mapk9)
   04068 FoxO signaling pathway
    110304169 (Mapk9)
   04071 Sphingolipid signaling pathway
    110304169 (Mapk9)
   04024 cAMP signaling pathway
    110304169 (Mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110304169 (Mapk9)
   04137 Mitophagy - animal
    110304169 (Mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    110304169 (Mapk9)
   04215 Apoptosis - multiple species
    110304169 (Mapk9)
   04217 Necroptosis
    110304169 (Mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304169 (Mapk9)
   04530 Tight junction
    110304169 (Mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110304169 (Mapk9)
   04621 NOD-like receptor signaling pathway
    110304169 (Mapk9)
   04622 RIG-I-like receptor signaling pathway
    110304169 (Mapk9)
   04625 C-type lectin receptor signaling pathway
    110304169 (Mapk9)
   04660 T cell receptor signaling pathway
    110304169 (Mapk9)
   04658 Th1 and Th2 cell differentiation
    110304169 (Mapk9)
   04659 Th17 cell differentiation
    110304169 (Mapk9)
   04657 IL-17 signaling pathway
    110304169 (Mapk9)
   04664 Fc epsilon RI signaling pathway
    110304169 (Mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110304169 (Mapk9)
   04920 Adipocytokine signaling pathway
    110304169 (Mapk9)
   04912 GnRH signaling pathway
    110304169 (Mapk9)
   04914 Progesterone-mediated oocyte maturation
    110304169 (Mapk9)
   04917 Prolactin signaling pathway
    110304169 (Mapk9)
   04926 Relaxin signaling pathway
    110304169 (Mapk9)
   04935 Growth hormone synthesis, secretion and action
    110304169 (Mapk9)
  09156 Nervous system
   04728 Dopaminergic synapse
    110304169 (Mapk9)
   04723 Retrograde endocannabinoid signaling
    110304169 (Mapk9)
   04722 Neurotrophin signaling pathway
    110304169 (Mapk9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110304169 (Mapk9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110304169 (Mapk9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304169 (Mapk9)
   05231 Choline metabolism in cancer
    110304169 (Mapk9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110304169 (Mapk9)
   05212 Pancreatic cancer
    110304169 (Mapk9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110304169 (Mapk9)
   05012 Parkinson disease
    110304169 (Mapk9)
   05016 Huntington disease
    110304169 (Mapk9)
   05017 Spinocerebellar ataxia
    110304169 (Mapk9)
   05020 Prion disease
    110304169 (Mapk9)
   05022 Pathways of neurodegeneration - multiple diseases
    110304169 (Mapk9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110304169 (Mapk9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110304169 (Mapk9)
   04932 Non-alcoholic fatty liver disease
    110304169 (Mapk9)
   04931 Insulin resistance
    110304169 (Mapk9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110304169 (Mapk9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110304169 (Mapk9)
   05135 Yersinia infection
    110304169 (Mapk9)
   05133 Pertussis
    110304169 (Mapk9)
   05152 Tuberculosis
    110304169 (Mapk9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110304169 (Mapk9)
   05170 Human immunodeficiency virus 1 infection
    110304169 (Mapk9)
   05161 Hepatitis B
    110304169 (Mapk9)
   05171 Coronavirus disease - COVID-19
    110304169 (Mapk9)
   05162 Measles
    110304169 (Mapk9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110304169 (Mapk9)
   05169 Epstein-Barr virus infection
    110304169 (Mapk9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110304169 (Mapk9)
   05142 Chagas disease
    110304169 (Mapk9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110304169 (Mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110304169 (Mapk9)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110304169 (Mapk9)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110304169 (Mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 110304169
NCBI-ProteinID: XP_021031063
Ensembl: MGP_CAROLIEiJ_G0016279
UniProt: A0A6P5QK09
LinkDB
Position
11
AA seq 423 aa
MSDSKIDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVVFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaaatcgatggtcagttttacagtgtgcaggtggcggactcaactttc
actgttctaaaacgttaccagcaactgaaaccgatcggctctggagcccaaggaattgtt
tgtgctgcttttgatacagttcttgggataaatgtggctgtcaagaagttaagtcgtcct
tttcagaaccaaacgcacgctaagagagcctaccgtgaactcgtcctcttaaagtgtgtc
aatcataaaaacataattagcttgttaaatgtgttcacaccacaaaaaacgctagaagaa
tttcaagatgtgtacttggtaatggaattaatggatgctaacttatgtcaggttattcat
atggagctggaccatgaaagaatgtcataccttctctaccagatgctttgtggcatcaag
catctgcattcagctggtatcattcatagagatttgaagcctagcaacattgtagtaaaa
tcagactgtaccctcaagatccttgactttggcctggcgcgaacagcctgtaccaacttt
atgatgactccctatgtggtaactcgctactatcgggctccagaagtcatcctgggcatg
ggctacaaagagaatgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtggtattccaaggtactgaccatattgatcagtggaataaagttattgaacag
ctaggaacaccatccgcagagttcatgaagaagcttcagccaactgtaaggaattatgtg
gaaaacagaccaaagtaccctgggatcaagtttgaagagctctttccagattggatattt
ccgtcagagtccgagagagacaaaatcaaaacaagtcaagccagagatctgttatcaaaa
atgttagtgattgatccagacaagcggatctctgtggacgaagccttgcgccacccgtat
attactgtttggtatgaccccgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagagcatgcgattgaagagtggaaagagctaatttacaaagaagtg
atggactgggaagaaagaagcaagaatggggtaaaagaccagccttcagatgcagcagta
agtagcaaggctactccttctcagtcgtcatccatcaatgacatctcatccatgtccact
gagcacaccctggcctcagacacagacagcagtctcgatgcctcaacaggacccctggaa
ggctgccgatga

KEGG   Mus caroli (Ryukyu mouse): 110308920
Entry
110308920         CDS       T05910                                 

Gene name
Mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04024  cAMP signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04137  Mitophagy - animal
mcal04140  Autophagy - animal
mcal04141  Protein processing in endoplasmic reticulum
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04310  Wnt signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04530  Tight junction
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04728  Dopaminergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04917  Prolactin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04926  Relaxin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05162  Measles
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05231  Choline metabolism in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110308920 (Mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110308920 (Mapk8)
   04012 ErbB signaling pathway
    110308920 (Mapk8)
   04014 Ras signaling pathway
    110308920 (Mapk8)
   04310 Wnt signaling pathway
    110308920 (Mapk8)
   04668 TNF signaling pathway
    110308920 (Mapk8)
   04068 FoxO signaling pathway
    110308920 (Mapk8)
   04071 Sphingolipid signaling pathway
    110308920 (Mapk8)
   04024 cAMP signaling pathway
    110308920 (Mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110308920 (Mapk8)
   04137 Mitophagy - animal
    110308920 (Mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    110308920 (Mapk8)
   04215 Apoptosis - multiple species
    110308920 (Mapk8)
   04217 Necroptosis
    110308920 (Mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110308920 (Mapk8)
   04530 Tight junction
    110308920 (Mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110308920 (Mapk8)
   04621 NOD-like receptor signaling pathway
    110308920 (Mapk8)
   04622 RIG-I-like receptor signaling pathway
    110308920 (Mapk8)
   04625 C-type lectin receptor signaling pathway
    110308920 (Mapk8)
   04660 T cell receptor signaling pathway
    110308920 (Mapk8)
   04658 Th1 and Th2 cell differentiation
    110308920 (Mapk8)
   04659 Th17 cell differentiation
    110308920 (Mapk8)
   04657 IL-17 signaling pathway
    110308920 (Mapk8)
   04664 Fc epsilon RI signaling pathway
    110308920 (Mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110308920 (Mapk8)
   04920 Adipocytokine signaling pathway
    110308920 (Mapk8)
   04912 GnRH signaling pathway
    110308920 (Mapk8)
   04914 Progesterone-mediated oocyte maturation
    110308920 (Mapk8)
   04917 Prolactin signaling pathway
    110308920 (Mapk8)
   04926 Relaxin signaling pathway
    110308920 (Mapk8)
   04935 Growth hormone synthesis, secretion and action
    110308920 (Mapk8)
  09156 Nervous system
   04728 Dopaminergic synapse
    110308920 (Mapk8)
   04723 Retrograde endocannabinoid signaling
    110308920 (Mapk8)
   04722 Neurotrophin signaling pathway
    110308920 (Mapk8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110308920 (Mapk8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110308920 (Mapk8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308920 (Mapk8)
   05231 Choline metabolism in cancer
    110308920 (Mapk8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110308920 (Mapk8)
   05212 Pancreatic cancer
    110308920 (Mapk8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110308920 (Mapk8)
   05012 Parkinson disease
    110308920 (Mapk8)
   05016 Huntington disease
    110308920 (Mapk8)
   05017 Spinocerebellar ataxia
    110308920 (Mapk8)
   05020 Prion disease
    110308920 (Mapk8)
   05022 Pathways of neurodegeneration - multiple diseases
    110308920 (Mapk8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110308920 (Mapk8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110308920 (Mapk8)
   04932 Non-alcoholic fatty liver disease
    110308920 (Mapk8)
   04931 Insulin resistance
    110308920 (Mapk8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110308920 (Mapk8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110308920 (Mapk8)
   05135 Yersinia infection
    110308920 (Mapk8)
   05133 Pertussis
    110308920 (Mapk8)
   05152 Tuberculosis
    110308920 (Mapk8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110308920 (Mapk8)
   05170 Human immunodeficiency virus 1 infection
    110308920 (Mapk8)
   05161 Hepatitis B
    110308920 (Mapk8)
   05171 Coronavirus disease - COVID-19
    110308920 (Mapk8)
   05162 Measles
    110308920 (Mapk8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110308920 (Mapk8)
   05169 Epstein-Barr virus infection
    110308920 (Mapk8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110308920 (Mapk8)
   05142 Chagas disease
    110308920 (Mapk8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110308920 (Mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110308920 (Mapk8)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110308920 (Mapk8)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110308920 (Mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 110308920
NCBI-ProteinID: XP_021036942
Ensembl: MGP_CAROLIEiJ_G0019102
UniProt: A0A6P5R4F2
LinkDB
Position
14
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAMINGSQHPSSSPSVNDMSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaaacgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctaaaacgataccagaatttaaagcctataggctcaggagctcaaggaatagtg
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctcagccggcca
tttcagaatcagacccatgctaagcgcgcctaccgagaactagttcttatgaagtgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagttagatcatgaaagaatgtcctaccttctctatcaaatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcctagtaatatagtagtgaaa
tcagactgcactttgaagattcttgattttggactggcgaggactgcaggaacgagtttt
atgatgacgccttatgtggtgactcggtactacagagcaccagaggtcattctcggcatg
ggctacaaggagaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
ctcggaacaccttgtcctgaattcatgaagaaacttcaaccaacagtaaggacttacgtt
gaaaacaggcctaaatacgctggctatagctttgagaaactgttccccgatgtgcttttc
ccagctgactcagagcataacaaacttaaagccagtcaggcaagagatttgttatccaaa
atgctagtaatagatgcatccaaaaggatctccgtagatgaagctctccagcacccatac
atcaacgtctggtatgatccttcagaagcagaagccccaccaccaaagatcccggacaag
cagttagatgagagggagcacacaatagaggagtggaaagaactgatatacaaggaggta
atggatttggaggaacgaactaagaatggagtcataagagggcagccgtctcctttaggt
gcagcaatgatcaatggctctcagcatccatcgtcttcgccgtctgtcaatgacatgtct
tcaatgtccacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

DBGET integrated database retrieval system