KEGG   Mus caroli (Ryukyu mouse): 110294216
Entry
110294216         CDS       T05910                                 

Gene name
Hgf
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal05144  Malaria
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05211  Renal cell carcinoma
mcal05218  Melanoma
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110294216 (Hgf)
   04014 Ras signaling pathway
    110294216 (Hgf)
   04015 Rap1 signaling pathway
    110294216 (Hgf)
   04020 Calcium signaling pathway
    110294216 (Hgf)
   04151 PI3K-Akt signaling pathway
    110294216 (Hgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110294216 (Hgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294216 (Hgf)
   05205 Proteoglycans in cancer
    110294216 (Hgf)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110294216 (Hgf)
   05226 Gastric cancer
    110294216 (Hgf)
   05218 Melanoma
    110294216 (Hgf)
   05211 Renal cell carcinoma
    110294216 (Hgf)
   05223 Non-small cell lung cancer
    110294216 (Hgf)
  09174 Infectious disease: parasitic
   05144 Malaria
    110294216 (Hgf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110294216 (Hgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110294216 (Hgf)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110294216 (Hgf)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110294216 (Hgf)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110294216 (Hgf)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316
Other DBs
NCBI-GeneID: 110294216
NCBI-ProteinID: XP_021017935
Ensembl: MGP_CAROLIEiJ_G0026973
UniProt: A0A6P5PJD0
LinkDB
Position
5
AA seq 728 aa
MMWGTKLLPVLLLQHVLLHLLLLHVAIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLLKI
KTKKVNSADECANRCIRNRGFTFTCKAFVFDKSKKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSPLNETDVP
METTECIQGQGEGYRGTSNTIWNGTPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHVCGGSLIKETWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgatgtgggggaccaaacttctgccggtcctgttgctgcagcatgttctcctgcacctc
ctcctgcttcatgtcgccatcccctatgcagaaggacagaagaaaagaagaaatacactt
catgaattcaaaaagtcagcaaaaactactcttaccaaggaagacccattactgaagatt
aaaaccaaaaaagtgaactctgccgatgagtgtgccaacaggtgtatcaggaacaggggc
tttaccttcacttgcaaggccttcgtttttgataagtcaaaaaaacgatgctactggtat
cctttcaatagcatgtcaagtggagtgaaaaaagggtttggccatgaatttgacctctat
gaaaacaaagactatattagaaactgcatcattggtaaaggaggcagctataaagggacg
gtatccatcactaagagtggcatcaaatgccagccttggaattccatgatcccccatgaa
cacagctttttgccttcgagctatcgcggtaaagacctacaggaaaactactgtcgaaat
cctcgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaa
gtctgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggtgaaagctac
agaggtcccatggatcacacagaatccggcaagacttgtcagcgctgggaccagcagaca
ccacaccggcacaagttcttgccagaaagatatcccgacaagggctttgatgataattat
tgccgcaatcctgatggcaagccgaggccatggtgctacactcttgaccctgacacccct
tgggagtattgtgcaattaaaacgtgcgctcacagtcctctgaatgagactgatgtccct
atggaaacaactgaatgcattcaaggccaaggagaaggttacaggggaaccagcaatacc
atttggaatggaactccctgtcaacgttgggattcgcagtaccctcacaagcatgatatc
actcccgagaacttcaaatgcaaggaccttagagaaaattattgccgcaatccagatggg
gctgaatcaccatggtgttttaccactgacccaaacatccgagttggctactgctctcaa
attcccaagtgtgacgtgtcaagtggacaagattgttatcgtggcaatgggaaaaattac
atgggcaacttatccaaaacaaggtctggacttacatgttccatgtgggacaagaatatg
gaggatttacaccgtcatatcttctgggagccagatgctagcaaattgaataagaattac
tgccggaatcctgatgatgatgcccatggaccttggtgctacacagggaatcctcttatt
ccttgggattattgccctatttcccgttgtgaaggagatactacacctacaattgtcaat
ttggaccatcctgtaatatcctgtgccaaaacaaaacaactgcgggttgtaaatggcatt
ccaacacaaacaacagtagggtggatggttagtttgaaatacagaaacaaacatgtctgt
ggaggatcactgataaaggaaacttgggttcttactgccagacaatgctttccagccaga
aacaaagacttgaaagactatgaagcttggcttggcatccacgatgtgcatgagagaggc
gaggagaagcgcaagcagatcttaaacatttcccagctggtctatggacctgaaggctca
gacttggttttactgaagcttgctcgacctgcaatcctggataactttgtcagtacaatt
gatttacctagttatggttgtacaatccctgaaaagaccacctgcagtatttacggctgg
ggctacactggattgatcaacgcggatggtttactacgagtagctcatctgtatattatg
gggaatgagaaatgcagtcagcaccatcaaggcaaggtgactttgaatgagtctgagtta
tgtgctggggctgaaaaaattggatcaggaccttgtgagggagattatggtggcccactc
atttgtgaacaacacaaaatgagaatggttcttggtgtcattgttcctggtcgtggatgt
gccatcccaaatcgtcctggtatttttgttcgagtagcatattatgcaaaatggatacac
aaagtaattttgacatacaagttgtaa

DBGET integrated database retrieval system