KEGG   Mus caroli (Ryukyu mouse): 110294321
Entry
110294321         CDS       T05910                                 

Gene name
Rheb
Definition
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04218  Cellular senescence
mcal04714  Thermogenesis
mcal04910  Insulin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    110294321 (Rheb)
   04151 PI3K-Akt signaling pathway
    110294321 (Rheb)
   04152 AMPK signaling pathway
    110294321 (Rheb)
   04150 mTOR signaling pathway
    110294321 (Rheb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110294321 (Rheb)
  09143 Cell growth and death
   04218 Cellular senescence
    110294321 (Rheb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110294321 (Rheb)
   04919 Thyroid hormone signaling pathway
    110294321 (Rheb)
  09149 Aging
   04211 Longevity regulating pathway
    110294321 (Rheb)
  09159 Environmental adaptation
   04714 Thermogenesis
    110294321 (Rheb)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    110294321 (Rheb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110294321 (Rheb)
   05163 Human cytomegalovirus infection
    110294321 (Rheb)
   05165 Human papillomavirus infection
    110294321 (Rheb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mcal04031]
    110294321 (Rheb)
GTP-binding proteins [BR:mcal04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    110294321 (Rheb)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 110294321
NCBI-ProteinID: XP_021018123
Ensembl: MGP_CAROLIEiJ_G0027024
UniProt: A0A6P5PPC1
LinkDB
Position
5
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFKRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcctcagtccaagtcccggaagatcgccatcctgggctaccggtctgtgggaaagtcc
tcattgacaattcagtttgttgaaggccaatttgttgattcctacgatccaaccatagag
aacacgttcaccaagttgatcacagtaaatggtcaagagtatcatcttcagcttgtagac
acagcggggcaggatgaatattccatttttcctcagacatactccatagatattaatggt
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtaattaaagttatccat
ggcaagttgttggatatggtggggaaagtgcagatacctattatgttggttggaaataag
aaggacctgcatatggaaagggtgatcagctatgaagaaggaaaggctttggcggaatct
tggaatgcagcgtttttggaatcttctgctaaagaaaatcaaactgctgttgatgttttt
aaaaggataattttggaagcagaaaagattgatggagcagcttcacagggaaagtcttcg
tgctcggtgatgtga

DBGET integrated database retrieval system