KEGG   Mus caroli (Ryukyu mouse): 110294345
Entry
110294345         CDS       T05910                                 

Gene name
Cdk6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04218  Cellular senescence
mcal04934  Cushing syndrome
mcal05160  Hepatitis C
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05212  Pancreatic cancer
mcal05214  Glioma
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110294345 (Cdk6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110294345 (Cdk6)
   04115 p53 signaling pathway
    110294345 (Cdk6)
   04218 Cellular senescence
    110294345 (Cdk6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294345 (Cdk6)
   05206 MicroRNAs in cancer
    110294345 (Cdk6)
   05203 Viral carcinogenesis
    110294345 (Cdk6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110294345 (Cdk6)
   05225 Hepatocellular carcinoma
    110294345 (Cdk6)
   05214 Glioma
    110294345 (Cdk6)
   05220 Chronic myeloid leukemia
    110294345 (Cdk6)
   05218 Melanoma
    110294345 (Cdk6)
   05224 Breast cancer
    110294345 (Cdk6)
   05222 Small cell lung cancer
    110294345 (Cdk6)
   05223 Non-small cell lung cancer
    110294345 (Cdk6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110294345 (Cdk6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110294345 (Cdk6)
   05164 Influenza A
    110294345 (Cdk6)
   05162 Measles
    110294345 (Cdk6)
   05163 Human cytomegalovirus infection
    110294345 (Cdk6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110294345 (Cdk6)
   05169 Epstein-Barr virus infection
    110294345 (Cdk6)
   05165 Human papillomavirus infection
    110294345 (Cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110294345 (Cdk6)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110294345 (Cdk6)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110294345 (Cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 110294345
NCBI-ProteinID: XP_021018170
Ensembl: MGP_CAROLIEiJ_G0026928
UniProt: A0A6P5PJV9
LinkDB
Position
5
AA seq 326 aa
MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLQGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLMFNPAKRISAYGALNHPYF
QDLERYKDNLHSHQPSNQSTSELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacagcctgagtcgcgccgatcagcagtatgagtgcgtggcggagatcggc
gaaggcgcctacgggaaggtgttcaaggcccgggacctgaagaacggcggccgcttcgtg
gctctgaagcgcgtgcgagtgcagaccagtgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacggacagacagagaaaccaagcttacactagtgtttgagcat
gttgatcaagacttgaccacttacttggataaagttccagagcctggcgtacccacagaa
actataaaggatatgatgtttcagcttctccaaggtctggactttcttcattctcacaga
gtagtgcatcgcgatctgaaaccgcagaacattctggtgaccagcagtggacagataaag
ctggctgactttggccttgcccgcatctatagttttcagatggcccttacctcagtggtc
gtcacgctgtggtaccgagccccagaagtcctgctccagtccagctatgccacccctgtg
gacctctggagtgtcggttgcatctttgcagaaatgtttcgcagaaagcctctttttcgt
ggaagttcagacgtggatcaactagggaaaatcttggatgtcattggactcccaggagag
gaagactggcctagggacgtggcccttccccggcaggcttttcattccaaatctgcccaa
cccatcgagaagtttgtgacagatattgacgaactaggcaaagacctacttttgaaatgt
ctgatgtttaatccagctaaaaggatatccgcctacggcgccctgaatcacccgtacttc
caagatctggagagatacaaggacaacctgcactctcaccagccatccaaccagagcacc
tcggagctgaacacagcctga

KEGG   Mus caroli (Ryukyu mouse): 110303132
Entry
110303132         CDS       T05910                                 

Gene name
Cdk4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04218  Cellular senescence
mcal04530  Tight junction
mcal04660  T cell receptor signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04934  Cushing syndrome
mcal05160  Hepatitis C
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05212  Pancreatic cancer
mcal05214  Glioma
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110303132 (Cdk4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110303132 (Cdk4)
   04115 p53 signaling pathway
    110303132 (Cdk4)
   04218 Cellular senescence
    110303132 (Cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110303132 (Cdk4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110303132 (Cdk4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303132 (Cdk4)
   05203 Viral carcinogenesis
    110303132 (Cdk4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110303132 (Cdk4)
   05225 Hepatocellular carcinoma
    110303132 (Cdk4)
   05214 Glioma
    110303132 (Cdk4)
   05220 Chronic myeloid leukemia
    110303132 (Cdk4)
   05218 Melanoma
    110303132 (Cdk4)
   05219 Bladder cancer
    110303132 (Cdk4)
   05224 Breast cancer
    110303132 (Cdk4)
   05222 Small cell lung cancer
    110303132 (Cdk4)
   05223 Non-small cell lung cancer
    110303132 (Cdk4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110303132 (Cdk4)
   04934 Cushing syndrome
    110303132 (Cdk4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110303132 (Cdk4)
   05160 Hepatitis C
    110303132 (Cdk4)
   05164 Influenza A
    110303132 (Cdk4)
   05162 Measles
    110303132 (Cdk4)
   05163 Human cytomegalovirus infection
    110303132 (Cdk4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110303132 (Cdk4)
   05169 Epstein-Barr virus infection
    110303132 (Cdk4)
   05165 Human papillomavirus infection
    110303132 (Cdk4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110303132 (Cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110303132 (Cdk4)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110303132 (Cdk4)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110303132 (Cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 110303132
NCBI-ProteinID: XP_021029742
Ensembl: MGP_CAROLIEiJ_G0015878
UniProt: A0A6P5QH23
LinkDB
Position
10
AA seq 303 aa
MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
EVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES
DAE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctgccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg
tacaaagcccgagatccccacagtggccactttgtggccctcaagagtgtgagagttcct
aatggaggagcagctggagggggccttcccgtcagcacagttcgtgaggtggccttgtta
aggaggctggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact
tcccgaactgatcgggacatcaaggtcaccctagtgtttgagcatatagaccaggacctg
aggacatacctggacaaagcacctccaccgggcctgccagttgagaccattaaggatctg
atgcgtcagtttctaagcggccttgattttcttcatgcaaactgcattgttcaccgggac
ctgaagccagagaacattctagtgacaagtaatgggactgtcaagctggctgactttggc
ctagctagaatctacagctaccagatggccctcacacctgtggtggttacgctctggtac
cgagctcctgaagttcttctgcagtctacatacgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgtttcgtcggaagcctctcttctgtggaaactctgaggct
gaccagttggggaaaatctttgatctcattggattgcctccagaagacgactggcctcga
gaggtatctctacctcgaggagcctttgcccccagagggcctcggccagtgcagtcagtg
gtgccagagatggaggagtctggagcgcagctgctactggaaatgctgacctttaaccca
cataagcgaatctctgccttccgagccctgcagcactcctacctgcacaaggaggaaagc
gacgcagagtga

DBGET integrated database retrieval system