KEGG   Mus caroli (Ryukyu mouse): 110294372Help
Entry
110294372         CDS       T05910                                 

Gene name
Galnt17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00512  Mucin type O-glycan biosynthesis
mcal00514  Other types of O-glycan biosynthesis
mcal01100  Metabolic pathways
Module
mcal_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    110294372 (Galnt17)
   00514 Other types of O-glycan biosynthesis
    110294372 (Galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mcal01003]
    110294372 (Galnt17)
Enzymes [BR:mcal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     110294372 (Galnt17)
Glycosyltransferases [BR:mcal01003]
 O-Glycan biosynthesis
  Mucin-type
   110294372 (Galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 110294372
NCBI-ProteinID: XP_021018223
Ensembl: MGP_CAROLIEiJ_G0027804
LinkDB All DBs
Position
5
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVIFLAKCRPIAVRSGEAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPSEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWAIKNPIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgaggagagtcaaagtgttgttggtgttgaacttgatcgcggtggccggc
ttcgtgatctttttggctaagtgtcggcctatcgcggtgcgcagcggagaagccttccac
gagattcggcctcgcgcagaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcttgtcgctgctggaggacatcgtctacaggcagcttaatggc
ttatctaaatcccttgggctcatcgaagggtatggtgggaggggcaaaggaggccttcct
gccaccctttccccctctgaagaagaaaaagccaaaggacctcatgagaaatatggctac
aattcctacctcagtgaaaagatctccttggaccggtctattccagattatcgtcctacc
aagtgtaaggagctcaaatattccaaggaattgccccagatatccatcatcttcatcttc
gtgaatgaggccctgtctgtgatacttcggtcagtccacagcgctgtcaatcacacaccc
acacacctgctgaaggagatcatcctggtggatgacaacagtgatgaagaggagctgaag
gcccccttggaagagtacgtccacaaacgctaccctgggctggtgaaggtggtacgcaat
caaaagcgagaaggcctgattcgagcacgcatcgagggctggaaagcggccactggccag
gtcactggctttttcgatgctcacgtggaattcactgctggctgggctgagcccgttctg
tcccgcatccaggaaaaccggaagcgggtcatcctcccctccatcgataacatcaagcag
gacaacttcgaagtgcagcgctacgagaactccgcccatgggtacagctgggagctgtgg
tgcatgtacatcagccccccgaaagactggtgggacgcaggagatccctctctccccatc
agaacaccagccatgattggctgctcatttgtggtcaacaggaaattctttggtgaaatt
ggtctgctggaccctggaatggatgtgtacggaggagagaatattgagcttggaatcaag
gtatggctctgtggtggcagcatggaggtccttccatgttcaagggtggcccacattgag
cggaagaagaaaccgtataacagtaacatcggcttctacaccaagaggaatgcactgcga
gtagccgaggtctggatggacgactacaagtcacatgtgtacatagcgtggaatctgcct
ctggagaatccaggcatcgatatcggtgacgtctcagaaagaaaagcattaaggaaaagt
ttgaaatgtaagaatttccagtggtatttggaccatgtttacccagaaatgagaagatac
aacaacactatcgcctatggggagcttcgtaataataaggccaaggatgtctgtctggac
caggggccactggaaaaccacacagcaatactgtacccatgccacggttggggaccacag
ctcgcccgctacaccaaggaaggcttcctgcacttaggtgctctggggaccaccactctc
ctccctgatacccgctgcctggtggataactccaagagtcggttgccgcagctcctggat
tgtgacaaggtcaagagcagcttgtacaagcgttggaacttcatccagaatggagccatc
atgaataagggcacagggcgctgcctagaggtggagaaccggggcctggccggcatcgac
ctaattcttcgaagctgtacgggacagagatgggcaatcaagaatcccatcaagtag

DBGET integrated database retrieval system