KEGG   Mus caroli (Ryukyu mouse): 110294471
Entry
110294471         CDS       T05910                                 

Gene name
Akt3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04370  VEGF signaling pathway
mcal04371  Apelin signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04910  Insulin signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04922  Glucagon signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04926  Relaxin signaling pathway
mcal04929  GnRH secretion
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05017  Spinocerebellar ataxia
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110294471 (Akt3)
   04012 ErbB signaling pathway
    110294471 (Akt3)
   04014 Ras signaling pathway
    110294471 (Akt3)
   04015 Rap1 signaling pathway
    110294471 (Akt3)
   04370 VEGF signaling pathway
    110294471 (Akt3)
   04371 Apelin signaling pathway
    110294471 (Akt3)
   04630 JAK-STAT signaling pathway
    110294471 (Akt3)
   04668 TNF signaling pathway
    110294471 (Akt3)
   04066 HIF-1 signaling pathway
    110294471 (Akt3)
   04068 FoxO signaling pathway
    110294471 (Akt3)
   04072 Phospholipase D signaling pathway
    110294471 (Akt3)
   04071 Sphingolipid signaling pathway
    110294471 (Akt3)
   04024 cAMP signaling pathway
    110294471 (Akt3)
   04022 cGMP-PKG signaling pathway
    110294471 (Akt3)
   04151 PI3K-Akt signaling pathway
    110294471 (Akt3)
   04152 AMPK signaling pathway
    110294471 (Akt3)
   04150 mTOR signaling pathway
    110294471 (Akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110294471 (Akt3)
  09143 Cell growth and death
   04210 Apoptosis
    110294471 (Akt3)
   04218 Cellular senescence
    110294471 (Akt3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110294471 (Akt3)
   04550 Signaling pathways regulating pluripotency of stem cells
    110294471 (Akt3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110294471 (Akt3)
   04613 Neutrophil extracellular trap formation
    110294471 (Akt3)
   04620 Toll-like receptor signaling pathway
    110294471 (Akt3)
   04625 C-type lectin receptor signaling pathway
    110294471 (Akt3)
   04660 T cell receptor signaling pathway
    110294471 (Akt3)
   04662 B cell receptor signaling pathway
    110294471 (Akt3)
   04664 Fc epsilon RI signaling pathway
    110294471 (Akt3)
   04666 Fc gamma R-mediated phagocytosis
    110294471 (Akt3)
   04062 Chemokine signaling pathway
    110294471 (Akt3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110294471 (Akt3)
   04922 Glucagon signaling pathway
    110294471 (Akt3)
   04923 Regulation of lipolysis in adipocytes
    110294471 (Akt3)
   04920 Adipocytokine signaling pathway
    110294471 (Akt3)
   04929 GnRH secretion
    110294471 (Akt3)
   04915 Estrogen signaling pathway
    110294471 (Akt3)
   04914 Progesterone-mediated oocyte maturation
    110294471 (Akt3)
   04917 Prolactin signaling pathway
    110294471 (Akt3)
   04926 Relaxin signaling pathway
    110294471 (Akt3)
   04935 Growth hormone synthesis, secretion and action
    110294471 (Akt3)
   04919 Thyroid hormone signaling pathway
    110294471 (Akt3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110294471 (Akt3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110294471 (Akt3)
  09156 Nervous system
   04725 Cholinergic synapse
    110294471 (Akt3)
   04728 Dopaminergic synapse
    110294471 (Akt3)
   04722 Neurotrophin signaling pathway
    110294471 (Akt3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110294471 (Akt3)
  09149 Aging
   04211 Longevity regulating pathway
    110294471 (Akt3)
   04213 Longevity regulating pathway - multiple species
    110294471 (Akt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294471 (Akt3)
   05205 Proteoglycans in cancer
    110294471 (Akt3)
   05230 Central carbon metabolism in cancer
    110294471 (Akt3)
   05231 Choline metabolism in cancer
    110294471 (Akt3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110294471 (Akt3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110294471 (Akt3)
   05212 Pancreatic cancer
    110294471 (Akt3)
   05225 Hepatocellular carcinoma
    110294471 (Akt3)
   05226 Gastric cancer
    110294471 (Akt3)
   05214 Glioma
    110294471 (Akt3)
   05221 Acute myeloid leukemia
    110294471 (Akt3)
   05220 Chronic myeloid leukemia
    110294471 (Akt3)
   05218 Melanoma
    110294471 (Akt3)
   05211 Renal cell carcinoma
    110294471 (Akt3)
   05215 Prostate cancer
    110294471 (Akt3)
   05213 Endometrial cancer
    110294471 (Akt3)
   05224 Breast cancer
    110294471 (Akt3)
   05222 Small cell lung cancer
    110294471 (Akt3)
   05223 Non-small cell lung cancer
    110294471 (Akt3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110294471 (Akt3)
   05017 Spinocerebellar ataxia
    110294471 (Akt3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110294471 (Akt3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110294471 (Akt3)
   04931 Insulin resistance
    110294471 (Akt3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110294471 (Akt3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110294471 (Akt3)
   05135 Yersinia infection
    110294471 (Akt3)
   05152 Tuberculosis
    110294471 (Akt3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110294471 (Akt3)
   05170 Human immunodeficiency virus 1 infection
    110294471 (Akt3)
   05161 Hepatitis B
    110294471 (Akt3)
   05160 Hepatitis C
    110294471 (Akt3)
   05164 Influenza A
    110294471 (Akt3)
   05162 Measles
    110294471 (Akt3)
   05168 Herpes simplex virus 1 infection
    110294471 (Akt3)
   05163 Human cytomegalovirus infection
    110294471 (Akt3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110294471 (Akt3)
   05169 Epstein-Barr virus infection
    110294471 (Akt3)
   05165 Human papillomavirus infection
    110294471 (Akt3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110294471 (Akt3)
   05142 Chagas disease
    110294471 (Akt3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110294471 (Akt3)
   01524 Platinum drug resistance
    110294471 (Akt3)
   01522 Endocrine resistance
    110294471 (Akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110294471 (Akt3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110294471 (Akt3)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110294471 (Akt3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 PH_11
Other DBs
NCBI-GeneID: 110294471
NCBI-ProteinID: XP_021018418
Ensembl: MGP_CAROLIEiJ_G0014954
UniProt: A0A6P5PWN2
LinkDB
Position
1
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggttcattcataggctataaggag
aaacctcaagatgtggacttaccttatcccctcaacaacttctcagtggcaaaatgtcag
ttaatgaaaacagaacgaccaaagccaaatacatttattatcagatgtcttcagtggacc
actgttatagagagaacatttcatgtagatacaccagaggaaagagaagagtggacggaa
gctatccaagccgtagccgatcgattgcagaggcaagaagaggaaaggatgaattgtagt
ccaacctcacagattgataatataggagaagaagagatggatgcgtctacaacccatcat
aaaagaaagacgatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactcttactgaaagcagagtacta
aagaacaccagacatccatttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatggcggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattctggaaagattgtgtaccgtgatctcaagttggagaatttgatgctagat
aaggatggccatataaaaattacggattttgggctttgcaaagaagggatcacagatgca
gctaccatgaagacattctgtggcacaccagagtacctggcaccagaggtattagaagat
aatgactatggccgagccgtggactggtggggcttaggtgttgtcatgtatgaaatgatg
tgtggaaggttgcctttctacaaccaggatcatgagaaactctttgaattaatactaatg
gaagacattaaattcccccgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggagggccagatgatgcaaaagaaatcatg
aggcatagttttttttctggagtaaactggcaagatgtatatgacaaaaagcttgtacct
ccttttaagcctcaagtaacatctgaaacagacacccgatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaagtatgacgacgacggcatggacggcatg
gacaacgagcggcggccacacttccctcagttctcctactctgcaagcggacgggaataa

KEGG   Mus caroli (Ryukyu mouse): 110297609
Entry
110297609         CDS       T05910                                 

Gene name
Akt2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04370  VEGF signaling pathway
mcal04371  Apelin signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04910  Insulin signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04922  Glucagon signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04926  Relaxin signaling pathway
mcal04929  GnRH secretion
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05017  Spinocerebellar ataxia
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110297609 (Akt2)
   04012 ErbB signaling pathway
    110297609 (Akt2)
   04014 Ras signaling pathway
    110297609 (Akt2)
   04015 Rap1 signaling pathway
    110297609 (Akt2)
   04370 VEGF signaling pathway
    110297609 (Akt2)
   04371 Apelin signaling pathway
    110297609 (Akt2)
   04630 JAK-STAT signaling pathway
    110297609 (Akt2)
   04668 TNF signaling pathway
    110297609 (Akt2)
   04066 HIF-1 signaling pathway
    110297609 (Akt2)
   04068 FoxO signaling pathway
    110297609 (Akt2)
   04072 Phospholipase D signaling pathway
    110297609 (Akt2)
   04071 Sphingolipid signaling pathway
    110297609 (Akt2)
   04024 cAMP signaling pathway
    110297609 (Akt2)
   04022 cGMP-PKG signaling pathway
    110297609 (Akt2)
   04151 PI3K-Akt signaling pathway
    110297609 (Akt2)
   04152 AMPK signaling pathway
    110297609 (Akt2)
   04150 mTOR signaling pathway
    110297609 (Akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110297609 (Akt2)
  09143 Cell growth and death
   04210 Apoptosis
    110297609 (Akt2)
   04218 Cellular senescence
    110297609 (Akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110297609 (Akt2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110297609 (Akt2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110297609 (Akt2)
   04613 Neutrophil extracellular trap formation
    110297609 (Akt2)
   04620 Toll-like receptor signaling pathway
    110297609 (Akt2)
   04625 C-type lectin receptor signaling pathway
    110297609 (Akt2)
   04660 T cell receptor signaling pathway
    110297609 (Akt2)
   04662 B cell receptor signaling pathway
    110297609 (Akt2)
   04664 Fc epsilon RI signaling pathway
    110297609 (Akt2)
   04666 Fc gamma R-mediated phagocytosis
    110297609 (Akt2)
   04062 Chemokine signaling pathway
    110297609 (Akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110297609 (Akt2)
   04922 Glucagon signaling pathway
    110297609 (Akt2)
   04923 Regulation of lipolysis in adipocytes
    110297609 (Akt2)
   04920 Adipocytokine signaling pathway
    110297609 (Akt2)
   04929 GnRH secretion
    110297609 (Akt2)
   04915 Estrogen signaling pathway
    110297609 (Akt2)
   04914 Progesterone-mediated oocyte maturation
    110297609 (Akt2)
   04917 Prolactin signaling pathway
    110297609 (Akt2)
   04926 Relaxin signaling pathway
    110297609 (Akt2)
   04935 Growth hormone synthesis, secretion and action
    110297609 (Akt2)
   04919 Thyroid hormone signaling pathway
    110297609 (Akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110297609 (Akt2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110297609 (Akt2)
  09156 Nervous system
   04725 Cholinergic synapse
    110297609 (Akt2)
   04728 Dopaminergic synapse
    110297609 (Akt2)
   04722 Neurotrophin signaling pathway
    110297609 (Akt2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110297609 (Akt2)
  09149 Aging
   04211 Longevity regulating pathway
    110297609 (Akt2)
   04213 Longevity regulating pathway - multiple species
    110297609 (Akt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297609 (Akt2)
   05205 Proteoglycans in cancer
    110297609 (Akt2)
   05230 Central carbon metabolism in cancer
    110297609 (Akt2)
   05231 Choline metabolism in cancer
    110297609 (Akt2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110297609 (Akt2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110297609 (Akt2)
   05212 Pancreatic cancer
    110297609 (Akt2)
   05225 Hepatocellular carcinoma
    110297609 (Akt2)
   05226 Gastric cancer
    110297609 (Akt2)
   05214 Glioma
    110297609 (Akt2)
   05221 Acute myeloid leukemia
    110297609 (Akt2)
   05220 Chronic myeloid leukemia
    110297609 (Akt2)
   05218 Melanoma
    110297609 (Akt2)
   05211 Renal cell carcinoma
    110297609 (Akt2)
   05215 Prostate cancer
    110297609 (Akt2)
   05213 Endometrial cancer
    110297609 (Akt2)
   05224 Breast cancer
    110297609 (Akt2)
   05222 Small cell lung cancer
    110297609 (Akt2)
   05223 Non-small cell lung cancer
    110297609 (Akt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110297609 (Akt2)
   05017 Spinocerebellar ataxia
    110297609 (Akt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110297609 (Akt2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110297609 (Akt2)
   04931 Insulin resistance
    110297609 (Akt2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110297609 (Akt2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110297609 (Akt2)
   05135 Yersinia infection
    110297609 (Akt2)
   05152 Tuberculosis
    110297609 (Akt2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110297609 (Akt2)
   05170 Human immunodeficiency virus 1 infection
    110297609 (Akt2)
   05161 Hepatitis B
    110297609 (Akt2)
   05160 Hepatitis C
    110297609 (Akt2)
   05164 Influenza A
    110297609 (Akt2)
   05162 Measles
    110297609 (Akt2)
   05168 Herpes simplex virus 1 infection
    110297609 (Akt2)
   05163 Human cytomegalovirus infection
    110297609 (Akt2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110297609 (Akt2)
   05169 Epstein-Barr virus infection
    110297609 (Akt2)
   05165 Human papillomavirus infection
    110297609 (Akt2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110297609 (Akt2)
   05142 Chagas disease
    110297609 (Akt2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110297609 (Akt2)
   01524 Platinum drug resistance
    110297609 (Akt2)
   01522 Endocrine resistance
    110297609 (Akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110297609 (Akt2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110297609 (Akt2)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110297609 (Akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 110297609
NCBI-ProteinID: XP_021022114
Ensembl: MGP_CAROLIEiJ_G0029419
UniProt: A0A6P5PYA4
LinkDB
Position
7
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDAM
DYKCGSPSDSSTSEMMEVAVNKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLDPLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaggtatctgtcatcaaagaaggctggctccacaaacgtggtgaatacatcaag
acctggaggccacggtacttccttctgaagagtgatggatctttcattgggtataaggag
aggcccgaggcccctgaccagaccttaccccccctgaacaatttctctgtagcagaatgc
cagctgatgaagactgagaggccacgacctaacacctttgtcatacgctgcctgcagtgg
accacagtcattgagaggaccttccatgtagactctccagatgagagggaagaatggatg
cgggctatccagatggttgccaatagtctgaagcagcggggcccaggtgaggacgccatg
gattacaagtgtggctcccccagtgactcttccacatctgagatgatggaggtagctgtc
aacaaggcacgggccaaagtgaccatgaatgacttcgattatctcaaactcctcggcaag
ggcacctttggcaaggtcattctggttcgagagaaggccactggccgctattatgccatg
aagatcctgcggaaggaggtcatcattgcgaaggatgaagtcgcccacacagtcacagag
agccgggttctgcagaataccaggcaccccttccttacagccctcaagtacgccttccag
acccatgaccgcctgtgctttgtgatggagtatgccaacgggggtgagctgtttttccac
ctctctcgggagcgagtcttcacggaggatcgggcgcgcttttatggagcagagattgtg
tcagctctggagtatttacactcgagagatgtggtgtaccgtgacatcaagctggaaaac
cttatgttggacaaagatggccacatcaagatcactgactttggcttgtgcaaagagggc
atcagtgatggagccaccatgaaaaccttctgtggtaccccggagtacttggcgcctgag
gtgctggaggacaatgactatgggcgcgcagtggactggtgggggctgggtgtggtcatg
tatgagatgatgtgtggccgcctgccattctacaaccaggaccacgagcgcctctttgag
ctcatccttatggaggagatccgcttcccacgcacactcgggccagaggccaagtccctg
ctggctgggctgctgaagaaggacccaaagcagaggctcggcggaggtcccagtgatgcg
aaggaggtcatggaacataggttcttcctcagcatcaactggcaggacgtggtacagaaa
aagctcctgccacccttcaaacctcaggtcacttcagaagtggacacaaggtacttcgat
gacgagttcaccgcccagtccatcacaatcacacccccagaccgatatgacagcctggac
ccgctggaactggaccagcggacgcacttcccccagttctcctactcagccagcatccga
gagtga

KEGG   Mus caroli (Ryukyu mouse): 110307022
Entry
110307022         CDS       T05910                                 

Gene name
Akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04370  VEGF signaling pathway
mcal04371  Apelin signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04910  Insulin signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04922  Glucagon signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04926  Relaxin signaling pathway
mcal04929  GnRH secretion
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05017  Spinocerebellar ataxia
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110307022 (Akt1)
   04012 ErbB signaling pathway
    110307022 (Akt1)
   04014 Ras signaling pathway
    110307022 (Akt1)
   04015 Rap1 signaling pathway
    110307022 (Akt1)
   04370 VEGF signaling pathway
    110307022 (Akt1)
   04371 Apelin signaling pathway
    110307022 (Akt1)
   04630 JAK-STAT signaling pathway
    110307022 (Akt1)
   04668 TNF signaling pathway
    110307022 (Akt1)
   04066 HIF-1 signaling pathway
    110307022 (Akt1)
   04068 FoxO signaling pathway
    110307022 (Akt1)
   04072 Phospholipase D signaling pathway
    110307022 (Akt1)
   04071 Sphingolipid signaling pathway
    110307022 (Akt1)
   04024 cAMP signaling pathway
    110307022 (Akt1)
   04022 cGMP-PKG signaling pathway
    110307022 (Akt1)
   04151 PI3K-Akt signaling pathway
    110307022 (Akt1)
   04152 AMPK signaling pathway
    110307022 (Akt1)
   04150 mTOR signaling pathway
    110307022 (Akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110307022 (Akt1)
  09143 Cell growth and death
   04210 Apoptosis
    110307022 (Akt1)
   04218 Cellular senescence
    110307022 (Akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110307022 (Akt1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110307022 (Akt1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110307022 (Akt1)
   04613 Neutrophil extracellular trap formation
    110307022 (Akt1)
   04620 Toll-like receptor signaling pathway
    110307022 (Akt1)
   04625 C-type lectin receptor signaling pathway
    110307022 (Akt1)
   04660 T cell receptor signaling pathway
    110307022 (Akt1)
   04662 B cell receptor signaling pathway
    110307022 (Akt1)
   04664 Fc epsilon RI signaling pathway
    110307022 (Akt1)
   04666 Fc gamma R-mediated phagocytosis
    110307022 (Akt1)
   04062 Chemokine signaling pathway
    110307022 (Akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110307022 (Akt1)
   04922 Glucagon signaling pathway
    110307022 (Akt1)
   04923 Regulation of lipolysis in adipocytes
    110307022 (Akt1)
   04920 Adipocytokine signaling pathway
    110307022 (Akt1)
   04929 GnRH secretion
    110307022 (Akt1)
   04915 Estrogen signaling pathway
    110307022 (Akt1)
   04914 Progesterone-mediated oocyte maturation
    110307022 (Akt1)
   04917 Prolactin signaling pathway
    110307022 (Akt1)
   04926 Relaxin signaling pathway
    110307022 (Akt1)
   04935 Growth hormone synthesis, secretion and action
    110307022 (Akt1)
   04919 Thyroid hormone signaling pathway
    110307022 (Akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110307022 (Akt1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110307022 (Akt1)
  09156 Nervous system
   04725 Cholinergic synapse
    110307022 (Akt1)
   04728 Dopaminergic synapse
    110307022 (Akt1)
   04722 Neurotrophin signaling pathway
    110307022 (Akt1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110307022 (Akt1)
  09149 Aging
   04211 Longevity regulating pathway
    110307022 (Akt1)
   04213 Longevity regulating pathway - multiple species
    110307022 (Akt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110307022 (Akt1)
   05205 Proteoglycans in cancer
    110307022 (Akt1)
   05230 Central carbon metabolism in cancer
    110307022 (Akt1)
   05231 Choline metabolism in cancer
    110307022 (Akt1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110307022 (Akt1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110307022 (Akt1)
   05212 Pancreatic cancer
    110307022 (Akt1)
   05225 Hepatocellular carcinoma
    110307022 (Akt1)
   05226 Gastric cancer
    110307022 (Akt1)
   05214 Glioma
    110307022 (Akt1)
   05221 Acute myeloid leukemia
    110307022 (Akt1)
   05220 Chronic myeloid leukemia
    110307022 (Akt1)
   05218 Melanoma
    110307022 (Akt1)
   05211 Renal cell carcinoma
    110307022 (Akt1)
   05215 Prostate cancer
    110307022 (Akt1)
   05213 Endometrial cancer
    110307022 (Akt1)
   05224 Breast cancer
    110307022 (Akt1)
   05222 Small cell lung cancer
    110307022 (Akt1)
   05223 Non-small cell lung cancer
    110307022 (Akt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110307022 (Akt1)
   05017 Spinocerebellar ataxia
    110307022 (Akt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110307022 (Akt1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110307022 (Akt1)
   04931 Insulin resistance
    110307022 (Akt1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110307022 (Akt1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110307022 (Akt1)
   05135 Yersinia infection
    110307022 (Akt1)
   05152 Tuberculosis
    110307022 (Akt1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110307022 (Akt1)
   05170 Human immunodeficiency virus 1 infection
    110307022 (Akt1)
   05161 Hepatitis B
    110307022 (Akt1)
   05160 Hepatitis C
    110307022 (Akt1)
   05164 Influenza A
    110307022 (Akt1)
   05162 Measles
    110307022 (Akt1)
   05168 Herpes simplex virus 1 infection
    110307022 (Akt1)
   05163 Human cytomegalovirus infection
    110307022 (Akt1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110307022 (Akt1)
   05169 Epstein-Barr virus infection
    110307022 (Akt1)
   05165 Human papillomavirus infection
    110307022 (Akt1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110307022 (Akt1)
   05142 Chagas disease
    110307022 (Akt1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110307022 (Akt1)
   01524 Platinum drug resistance
    110307022 (Akt1)
   01522 Endocrine resistance
    110307022 (Akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110307022 (Akt1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110307022 (Akt1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110307022 (Akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 110307022
NCBI-ProteinID: XP_021034877
Ensembl: MGP_CAROLIEiJ_G0018156
UniProt: A0A6P7RX70
LinkDB
Position
12
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtagccattgtaaaggagggctggctgcacaaacgaggggaatatattaaa
acctggcggccacgctacttcctcctcaagaacgatggcacctttattggctacaaggaa
cggcctcaggatgtggatcagcgagagtccccactcaacaacttctcagtggcacaatgc
cagctgatgaagacagagcggccaaggcccaacacctttatcatccgctgcctgcagtgg
accacagtcattgagcgcaccttccatgtggaaacgcctgaggagcgggaagaatggacc
accgccattcagactgtggccgacggactcaagaggcaggaagaagagacgatggacttc
cgatcaggctcacccagtgacaactcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaagctactgggcaagggcacc
tttgggaaggtgatcctggtgaaagagaaggccacaggccgctactatgccatgaagatc
ctcaagaaggaggtcatcgtcgccaaggatgaggttgcccacacgcttactgagaaccgt
gtcctgcagaactctaggcatcccttccttacggccctcaagtactcattccagacccac
gaccgcctctgctttgtcatggagtatgccaacgggggtgagctcttcttccacctgtct
cgagagcgcgtgttctccgaggaccgggcccgcttctatggtgcggaaattgtgtctgcc
ctggactacttgcactcggagaagaacgtggtgtaccgggacctgaagctggagaacctt
atgctggacaaggacgggcacatcaagataacggacttcgggctgtgcaaagaggggatc
aaggacggtgccactatgaagacattctgcggaacgccggagtacctggcccctgaggtg
ctggaggacaacgactacggccgtgcagtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgtggtcgcctgcccttctacaaccaggaccacgagaagctgttcgagctg
atcctcatggaggagatccgcttcccacgcacactcggccctgaggccaagtccctgctc
tctgggctgctcaagaaggaccctacacagaggctcggtgggggctccgaggacgccaag
gagatcatgcagcaccggttctttgccaacatcgtgtggcaggatgtgtatgagaagaag
ctgagcccacctttcaagccccaggtcacctctgagactgacaccaggtatttcgatgag
gagttcacagctcagatgatcaccatcacgccacctgatcaagatgacagcatggagtgt
gtggacagtgagcggaggccgcacttcccccagttctcctactcagccagtggcacagcc
tga

DBGET integrated database retrieval system