KEGG   Mus caroli (Ryukyu mouse): 110294537
Entry
110294537         CDS       T05910                                 

Gene name
Flt3
Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04640  Hematopoietic cell lineage
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05221  Acute myeloid leukemia
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110294537 (Flt3)
   04014 Ras signaling pathway
    110294537 (Flt3)
   04151 PI3K-Akt signaling pathway
    110294537 (Flt3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110294537 (Flt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294537 (Flt3)
   05202 Transcriptional misregulation in cancer
    110294537 (Flt3)
   05230 Central carbon metabolism in cancer
    110294537 (Flt3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110294537 (Flt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110294537 (Flt3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110294537 (Flt3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110294537 (Flt3)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110294537 (Flt3)
CD molecules [BR:mcal04090]
 Proteins
  110294537 (Flt3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 APH
Other DBs
NCBI-GeneID: 110294537
NCBI-ProteinID: XP_021018499
Ensembl: MGP_CAROLIEiJ_G0028039
UniProt: A0A6P5PRD3
LinkDB
Position
5
AA seq 1000 aa
MRALAQRSDRRLLLLVVLSVMILETVTNQDLPVIKCVLISHENNGSSAGKPSSYRMVRGS
PEDLQCTPRRQSEGMVYEAATVEVAESGSITLQVQLATPGDLSCLWVFKHSSLGCQPHFD
LQNRGIVSMAILNVTETQAGEYLLHIQSEAANYTVLFTVNVRDTQLYVLRRPYFRKMENQ
DALLCISEGVPEPTVEWVLCSSHRESCKEEGPAVVRKEEKVLHELFGTDIRCCARNALGR
ECTKLFTIDLNQAPQSTLPQLFLKVGEPLWIRCKAIHVNHGFGLTWELEDKALEEGSYFE
MSTYSTNRTMIRILLAFVSSAGRNDTGYYTCSSSKHPSQSALVTILEKGFINATSSQEEY
EIDPYEKFCFSVRFKAYPRIRCTWIFSQASFPCEQRGLEDGYSISKFCDHKNKPGEYIFY
AENDDAQFTKMFTLNIRKKPQVLANASASQASCSSDGYPLPSWTWKKCSDKSPNCTEEIP
EGVWNKKANRKVFGQWVSSSTLNMSEAGKGFLVKCCAYNSMGTSCETIFLNSPGPFPFIQ
DNISFYATIGLCLPFIVVLIVLICHKYKKQFRYESQLQMIQVTGPLDNEYFYVDFRDYEY
DLKWEFPRENLEFGKVLGSGAFGRVMNATAYGISKTGVSIQVAVKMLKEKADSCEREALM
SELKMMTHLGHHDNIVNLLGACTLSGPVYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFK
EHNFSFYPTFQAHSNSSMPGSREVQLHPPLDQLSGFNGNSIHSEDEIEYENQKRLAEEEE
EDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIL
SDSSYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDAN
FYKLIQSGFKMEQPFYATEGIYFVMQSCWAFDSRKRPSFPNLTSFLGCQLAEAEEAMYQN
MGGNVPEHPSIYQNRRPLSREAGSEPPSPQAQVKIHGERS
NT seq 3003 nt   +upstreamnt  +downstreamnt
atgcgggcgttggcgcagcgcagcgaccggcggctgctgctgcttgttgttttgtcagta
atgattcttgagaccgttacaaaccaagatctgcctgtgatcaagtgtgttttaatcagt
catgagaacaatggctcatcagcgggaaagccatcgtcgtaccgaatggtgcgaggatcc
ccggaagacctccagtgtaccccgaggcgccagagtgaagggatggtatatgaagcggcc
accgtggaggtggccgagtctgggtccatcaccctgcaagtgcagctcgccaccccaggg
gacctttcctgcctctgggtctttaagcacagctccctgggctgccagccgcattttgat
ttacaaaacagaggaatcgtttccatggccatcttgaacgtgacagagacccaggcagga
gaatacctactccatattcagagtgaagctgccaactacacagtactgttcacagtgaat
gtaagagatacacagctgtacgtgctaagaagaccttactttaggaagatggaaaaccag
gatgcactgctctgcatctccgagggtgttccggagcccactgtggagtgggtgctctgc
agctcccacagggaaagctgtaaagaagaaggccctgctgttgtcagaaaggaggaaaag
gtacttcatgagttgttcggaaccgacatcagatgctgtgctagaaatgcactgggccgc
gaatgcaccaagctattcaccatagatctaaatcaggctcctcagagcacactgccccag
ttattcctgaaagtgggggaaccgttgtggatcaggtgcaaggccatccatgtgaaccat
ggattcgggctcacctgggagctggaagacaaagccctggaggagggcagctactttgag
atgagtacctactccacaaacaggaccatgattcggattctcttggcctttgtgtcttct
gcgggaaggaacgacaccggatattatacctgctcttcctcaaagcaccccagccagtca
gcgttggtgaccatcctagaaaaagggtttataaacgctaccagctcacaagaagagtat
gaaattgacccatacgaaaagttctgcttctcagtcaggtttaaagcgtacccacgaatc
cgatgcacgtggatcttctctcaagcctcatttccttgtgagcagagaggcctggaggat
gggtacagcatatctaaattttgcgatcataagaacaagccaggagagtacatattctat
gcagaaaatgatgacgcccagttcaccaaaatgttcacgctgaatataagaaagaaacct
caagtgctcgcaaatgcctcagccagccaggcatcctgttcctctgatggctacccgtta
ccctcttggacctggaagaagtgttcggacaagtctcccaattgcaccgaggaaatccca
gaaggagtttggaataaaaaggctaacagaaaagtgtttggacagtgggtgtcgagcagt
actctaaatatgagtgaggccgggaaagggtttctggtcaaatgctgtgcatacaattct
atgggcacgtcttgcgaaaccatctttttaaactcaccaggccccttccctttcatccaa
gacaacatctccttctatgcaaccattgggctctgtctcccgttcattgtcgttctcatt
gtgttgatctgccacaaatacaaaaagcaatttaggtacgagagtcagctgcagatgatc
caggtgactggtcccctggataacgagtacttctacgttgacttcagggactatgaatat
gaccttaagtgggagtttccgagagagaacttagagtttgggaaggtcctggggtccggt
gctttcgggagggtgatgaatgccacggcctatgggattagtaaaacgggagtctcaatt
caggtggcggtgaagatgctaaaagagaaagctgacagctgtgaaagagaagctctcatg
tcagagctcaaaatgatgacccacctgggacaccatgacaacatcgtgaatctgctgggg
gcatgcacactgtcagggccagtgtacttgatttttgaatattgttgctatggtgacctc
ctcaactacctaagaagtaaaagagagaagtttcacaggacatggacagagatttttaag
gaacataatttcagtttttaccctactttccaggcacattcaaattccagtatgcctggt
tcacgagaagttcagttacacccgcccttggatcagctctcagggttcaatggaaattca
attcattctgaagatgagattgaatatgaaaaccagaagaggctggccgaagaagaggag
gaagatttgaacgtgctgacgtttgaagacctcctttgctttgcgtaccaagtggccaaa
ggcatggaattcctggagttcaagtcgtgtgtccacagagacctggcagccaggaatgtg
ttagtcacccacgggaaggtggtgaagatctgtgactttggactggcccgagacatcctg
agcgactccagctacgtcgtcaggggcaacgcacggctgccggtgaagtggatggcaccc
gagagcttgtttgaagggatctacacaatcaagagtgacgtctggtcctacggcatcctt
ctctgggagatattttcactgggtgtgaacccttaccctggcattcctgtcgacgctaac
ttctataaactgattcagagtggatttaaaatggagcagccattctatgccacagaaggg
atatactttgtaatgcaatcctgctgggcttttgactcaaggaagcggccatccttcccc
aacctgacttcatttttaggatgtcagctggcagaggcagaagaagcgatgtatcagaac
atgggtggcaacgtcccagaacatccatccatctaccaaaacaggcggcccctcagcaga
gaggcaggctcagagccgccatcgccacaggcccaggtgaagattcacggagaaagaagt
tag

DBGET integrated database retrieval system