KEGG   Mus caroli (Ryukyu mouse): 110294557
Entry
110294557         CDS       T05910                                 

Gene name
Brca2
Definition
(RefSeq) breast cancer type 2 susceptibility protein
  KO
K08775  breast cancer 2 susceptibility protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03440  Homologous recombination
mcal03460  Fanconi anemia pathway
mcal05200  Pathways in cancer
mcal05212  Pancreatic cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    110294557 (Brca2)
   03460 Fanconi anemia pathway
    110294557 (Brca2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294557 (Brca2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110294557 (Brca2)
   05224 Breast cancer
    110294557 (Brca2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110294557 (Brca2)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110294557 (Brca2)
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110294557 (Brca2)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    110294557 (Brca2)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110294557 (Brca2)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     110294557 (Brca2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     110294557 (Brca2)
SSDB
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower
Other DBs
NCBI-GeneID: 110294557
NCBI-ProteinID: XP_021018532
Ensembl: MGP_CAROLIEiJ_G0028060
UniProt: A0A6P5PWW7
LinkDB
Position
5
AA seq 3331 aa
MPVEYKRRPTFWEIFKARCSTADLGPISLNWFEELSSEAPPYNSEPPEESEYKPHGYEPQ
LFKTPQRNPPYHQFASTPIMFKERSQTLPLDQSPFRELGKVVASSKHKTHSKKKTKMDPV
VDVASPPLKSCLSESPLTLRCTQAVPQQEKPVVSGSLFYTPKLKEGQTPKPISESLGVEV
DPDMSWTSSLATPPTLSSTVLIARDEEARSSVTPADSPATLKSCFSNHNESPKKNDRSVP
PVIDSENKNQQEAFSQGLGKMLGDSSGKRNSFKDCLRKPIPNILEDGETAVDTSEEDSFS
LCFPKRRTRNLQKMRMGKTRKKIFSETRTDELSEEARRQTDDKNSFVFEMEPRESDPLDP
GVTSQKPFYSQTEEICNEAVQWSDSRWSQSNLSGLNEAQTGKIPLPHISSHSQNISEDFI
DMKREGTGSITSEKSLPHISSLSEPEKMFSEDTMVDKEHEGQHLESLEDSIAGKQMVSRT
SQAACLSPSIRKSIFKTREPLEETLGTVFSDSVTNSTFTEEHEASACGLGILTACSQRED
SLCPSSVDTGSWPTTLTDTSATVKNAGLISTLKNKRRKFIYSVSDDASLQGKKLQTHRQL
ELTNLSAQLEASAFEVPFTFTNVNSGIPDSSLKKSCLPNDPEEPSLTNSFGTATSKEISY
IHALISQDLNDKEAIVVEEKTQPYTALEAGFLLCLPERTCENDQKSPKVSNGKEKVLVSA
CLPSAVQLSSISFESQENPLGDHNGTSTLKLTPSSKPPLSKAVMVSREKMCKMPEKLQCE
SCKVNTELSKNILEVNEICVLSENSKTPGLLPPGENIIEMASSVKSQFNQNAKIVIQKDQ
KGSPFISEVAVNMNSEELFPDNGNNFAFQVTNDSNKPDLGSSVELQEEDLSHTKGPSLKN
SPMAVDEDVDDAHAAQVLITKDSDSLAVVHDYTEKSRNNIEQHQKGTEDKDFKSNSSLNM
KSDGNSDYSDKWSGFLDPVLNHNFGGSFRTASNKEIKLSEHNVKKSKMFFKDIEEQYPTS
LACIDIVNTLPLANQKKLSEPHTFDLKSVTTVSTQSHSSSSVSHEDTDTTPQMLKQDFHS
NNLTPSQKAEITELSTILEESGSQFEFTQFRKPSHIAQNTSEVPGNQMVVLSTASREWKD
NDLHLPVDPSVGQTDHSKQFEGSAGVKQSFPHLLEDTYNKNTSCFLPNINEMEFGGFCSA
LGTKLSVSNEALRKAMKLFSDIENSEEPSAKVGPRGFSSSAHHDSVASVFKIKKQNTDKS
FDEKSSKCQVTLQNNIEMTTCIFVGKNPEKYIKNTKHEDNYTSSQRNTYNLENSDGSKSS
TSGPVYIHKGGSDLPADQGSKCPESCTQYVREENTQIKENISDLTCLEIMKAEETCCMKS
SDKKQLPSDKMEQNIKEFNISFQTASGKNTRVSKESLNKSVNIFNQETDELTVISDSLNS
KIPHGINKDKMHISCHKKAISIKKVFEDHFPIGTVSQLPDQQHPEYEIESIKEPTLLGFH
TASGKKVKIMQESLDKVKNLFDETQYVRKTANFSHQGSKPLKDSMDSKEELTLAYEKIEV
TASKCEEMQNFVSKETEMLPQQNYHMCRQTENLKTSNGTSSKVQENIESNIEKNPRICCI
CQSSYPVTEDSALAYYTEDTRKTCVRESLSKGRKWLREQGDKLGTRNTIKIECVKEHTEN
FAGNASYEHSLVIIRTEIDTNHVSENQVSTFFSDPNVCHSYLSHSSFCHHDDMHNDSGYF
LKNKIDSDVPPDMKNAEGNTISPRVSATKERNLHPQTISEDCVQKLETNTSPHANKDVAI
DSSLLDSRNCKVGSLVFITAHSQETVRTKEIVTDNCNKIVEQNRKSKPGTCQTSCHKVLD
DSKDFICPSSSGDVCINSHKDNFCPHNEQILQHNQSMSGLKKAATPPVGLETWDTSKSIR
EPPQAVHPSRTYGIFSTASGKAVQVSDASLEKARQVFSEMDGDAKQLSSMVSLEGNEKSH
HSVKRENSVVHNTQGVLSLPKPLPGNVNSSVFSGFSTAGGKLVTVSESALHKVKGMLEEF
DLIRTEHTLQHSPIPEDVSKILPQPCAENRTPEYPVNSKLQKTYNDKSSLPSNYKETGSL
GNTQSIEVSLQLSQMGRNQDTRLVLGTKVSHSKANLLGKEQTLPQNIKVKTDEMKAFSDV
PVKTNGEYYSKESENYFETEAVESAKAFMEDDELTDSEQTHAKCSLFTCPQNETLFNLRT
RKRGVAVDTVGQPPIKRSLLNEFDKIIESKGKSLTPSKSTPDGTIKDRRLFTHHMSLEPV
TCGPFRSSKERQGAQHPHLTSPAQGLLSKGHPWSPLALEKSPSSPIVSVLPAHSVSVTRT
ERTRHSGKSTKVFVPPFKMKSQFHGDEHFNSKNVNLEEKNQKSTDGDRGDRNDSHDRPFN
KDLMSSLESARELQDMRIKNKERRHLRPQPGSLYLTKSSTLPRISLQAAVGDRAPSACSP
KQLYIYGVSKECINVNSKNAEYFQFDIQDHFGKEDLCAGKGFQLADGGWLIPSNDGKAGK
EEFYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLK
YRYDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTKVSETSGGKTSGEDANKVD
TIELTDGWYAVRAQLDPPLVALVKSGKLTVGQKIITQGAELVGSPDACAPLEAPDSLRLK
ISANSTRPARWHSKLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQRVYPLQWVEKTVSG
LYIFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFKDPEEDTTQRCVLSRALTRQQVHA
LQDGAELYAAVQDASDPDHLEACFSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAEK
EEGLSRDVTTVWKLRVTSYKKKEKSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSKSK
FERPSIQLTATKRTQYQQLPVSSETLLQVYQPRESLHFSRLSDPAFQPPCSEVDVVGVVV
SVVKPIGLAPLVYLSDECLNLLVVKFRIDLNEDIKPRVLIAASNLQCQPESTSGVPTLFA
GHFSIFSASPKEAYFQEKVNNLKHAIENIDTFYKEAEKKLIHVLKGDSPKWSTPNKGPTR
EPHAASTCCASDLLGAGGQFLRISPTGQQSYQSPLSHCTPKGKSTPLAHSAQMAAKSCGG
ENEIDDPKTCRKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQPPRSCGTKYATPIKKE
PSSPQRRTPFQKASGVSLPDCDSVADEELALLSTQALVPDSVGGNEQAFPGDSTRNPQPA
QRPDQHVGPRSRKESLRDCRGDSSEKLAVES
NT seq 9996 nt   +upstreamnt  +downstreamnt
atgccggttgaatacaaaaggagaccaactttttgggaaatttttaaggcgagatgcagc
acagcagatttaggaccgataagcctcaattggtttgaggaactttcctcagaagccccc
ccatacaattctgaacctccagaggaatcggagtataagccccacggttatgaaccacag
ctgtttaaaacaccacagaggaatcccccctaccatcagtttgcttcaactccaataatg
ttcaaagaaagaagtcagactctaccactggaccagtcgcctttcagagaattagggaag
gttgttgcaagtagtaaacataaaactcacagcaaaaagaagaccaaaatggaccctgtg
gtagatgttgctagtccgccactgaaatcttgtctcagtgaaagccctcttactctgcgg
tgcacacaggcagtaccacaacaagaaaagccagtggtatctggaagtttattttataca
ccaaaactcaaggagggtcagacaccaaaacctatttcggagagtctgggagttgaagtg
gatcctgatatgtcttggacaagttcattagctacaccaccaacccttagttccactgtg
ctcatagcccgagatgaagaagcacgtagctctgtaacgcctgccgactctcccgctact
ttgaaaagctgtttttctaaccacaatgaaagtccaaaaaaaaatgatagatctgttccc
ccagtgattgacagtgaaaacaaaaaccagcaagaagcttttagtcagggattggggaaa
atgttaggagattcatctggcaaaagaaatagcttcaaagactgccttagaaagccaata
ccaaatattctagaagatggggagacagctgttgatacttccgaagaagatagtttctca
ttatgttttcctaagcgtagaaccagaaatctacagaaaatgagaatgggcaagacaagg
aaaaagattttcagtgaaacacgaactgatgaattaagcgaagaagctagaagacaaact
gatgataaaaactcatttgtatttgaaatggaaccaagagagagtgatcccttagatcca
ggtgtaacaagccagaagcccttttacagccagactgaggaaatctgcaatgaagctgta
cagtggtcagatagtagatggtctcagtcaaacctttctggtctaaatgaagcccagaca
ggaaaaatacccttacctcatatttcttctcatagccaaaatatttcagaagacttcata
gatatgaagagagaaggtactggctctattacttcagaaaaatctttacctcatatttct
agtctttcagaaccggaaaagatgttcagtgaggatactatggtagataaggaacatgaa
ggacagcatcttgaatcacttgaagactccattgcagggaagcaaatggtgtctagaaca
agtcaagcagcctgtctgtctccgagtatcaggaagtctatattcaagacgagagagcca
cttgaagagactttgggtactgttttctcagatagtgtgaccaactcaacctttacagaa
gaacatgaagcctctgcgtgtggattgggaatacttactgcatgctcacagagagaggat
tctttatgtcctagttcagttgacactggaagctggccaaccactctcactgacacttct
gccactgtgaaaaatgcaggtttgatatccactctaaaaaataaaagaagaaagtttatt
tactctgtaagtgatgatgcatctcttcaaggaaaaaaactacagacacacagacagttg
gagcttactaatctttcagcccagcttgaagcaagtgcttttgaagtaccattcaccttt
acaaatgtaaattcaggtataccagattcttctctcaaaaaaagctgtttaccgaatgat
cctgaagagccatccttgaccaactcttttgggactgctaccagtaaagaaattagttat
attcatgcattgatatctcaggatcttaatgacaaagaagcaatagtcgttgaagaaaaa
acacagccatatacagccctagaagctggctttctgttatgcttgccagaaagaacatgt
gaaaatgaccaaaaaagtccaaaagtttccaatggaaaagaaaaagtcttagtttcagca
tgtcttccttcagcagtgcaactcagcagcattagctttgaatcacaggaaaaccctctt
ggtgaccacaacggaacaagtactcttaaattaactcccagctcaaagccacctctgtca
aaggcagtcatggtttctagagagaaaatgtgtaaaatgccagagaaactgcaatgtgag
agttgtaaagttaatactgaactaagcaaaaacatcttggaggtaaatgaaatatgtgtc
ttaagtgaaaattctaaaacccctgggcttctgccacctggtgaaaatataatagaaatg
gcctcttcagtgaagtcacagttcaatcaaaatgcaaaaatagtcatacagaaggaccaa
aaaggctcaccttttatttcagaagtagcagtcaatatgaactctgaagaacttttccca
gacaacgggaataattttgcttttcaagtaaccaatgacagcaataagcctgacttagga
agttcagtggaactccaggaagaagacctcagccacacaaaagggcctagtctcaagaac
tctcccatggcagtagatgaagatgtagatgatgcgcatgcagcccaagtgttgattaca
aaggactcagattcattagctgtggtccatgattatacagagaagagcagaaataatata
gagcagcatcagaaaggaaccgaagacaaagatttcaagtcaaattcctccttgaatatg
aaatcagatgggaacagtgattattcagacaaatggtcggggttcttggatccagtcttg
aaccataattttggaggtagcttcagaacagcttccaataaagaaataaaactttcagag
cataatgtcaagaaaagtaaaatgttcttcaaagatattgaagaacagtatcctactagt
ttagcttgtattgacattgttaatacccttccattagcaaaccagaagaaactaagtgaa
cctcatacatttgatttgaaatcagttactactgtatctacacagtctcatagttcatca
tctgtttctcatgaagatactgacacaacacctcagatgttaaagcaagattttcattca
aataatttaacgcccagccaaaaagcagaaattacagaactgtctactatcttggaagaa
tcaggaagtcagtttgaattcacacagttcagaaagccaagccacatagcacagaataca
tctgaagtgcctggaaaccagatggttgttttaagtactgcttctagggagtggaaagat
aatgatcttcacctcccagtggatccctctgtaggtcagacagatcacagcaagcaattt
gaaggttcagctggagttaaacaaagctttcctcacctgttagaagacacttataacaaa
aatacatcttgttttttaccaaatataaatgaaatggagtttggaggattttgttctgct
cttggcacaaaacttagtgtgtctaatgaggctctgagaaaagctatgaaactgttcagt
gacattgaaaatagtgaggagccttcggcaaaagtaggaccacgaggattctcttcaagt
gcacaccatgattctgttgcttcagtgtttaagataaagaaacaaaacactgataaaagt
tttgatgagaaatctagtaagtgccaagtaacattacaaaataatattgaaatgactacc
tgtatttttgttggcaaaaatcctgaaaaatacataaagaatacaaaacatgaagataac
tatactagctctcaaagaaatacttataatttagaaaactccgatggtagtaagtcaagt
acaagtggcccagtttatattcataaaggtggcagtgatttacctgccgatcaaggcagt
aagtgtcctgagtcatgtacccaatatgtgagagaggaaaacacacaaattaaggaaaat
atatcagatttaacatgtttggaaattatgaaagctgaggaaacgtgttgtatgaaatct
tcagataaaaaacaattaccttcagataagatggaacaaaatataaaagagtttaatata
tcctttcagactgcaagtgggaaaaataccagagtctccaaagagtcattaaataaaagt
gtgaatatttttaatcaggaaacagatgaattgactgtcatttcagattctttgaattct
aaaattcctcatggcataaataaggacaaaatgcatatttcatgtcacaagaaagcaatc
agtattaaaaaggtatttgaagaccatttcccaattggaactgtcagtcagttaccagat
cagcagcatcctgaatatgaaatagaaagtatcaaagaacctactctgttgggttttcat
acagctagtgggaaaaaagtcaaaattatgcaggaatctttggacaaagtgaaaaacctt
tttgatgagacacaatatgttaggaaaactgccaattttagtcatcaaggatcaaaaccc
ctgaaggacagtatggacagtaaagaagaacttacattagcatatgagaaaatagaagta
actgcctcaaaatgtgaagaaatgcagaactttgtctctaaggagactgaaatgctacct
cagcaaaattatcatatgtgtaggcaaactgaaaatctcaaaacatcaaatggtacctct
tccaaagtacaagaaaacatagaaagtaatatagaaaagaatcctagaatttgctgtatt
tgtcagtcctcttacccagtcactgaagattctgctttggcatattatacggaggacaca
aggaaaacttgtgtcagagagtctttatccaaaggcagaaaatggcttagagaacagggt
gataagcttggaacaagaaatactatcaaaattgagtgtgtaaaggaacacacagaaaat
tttgcaggaaatgcctcatatgaacatagtttggttattatcagaactgaaattgataca
aatcatgtctctgaaaaccaagtgtcaaccttctttagtgaccctaatgtgtgtcatagc
tatctatcccattctagtttttgtcatcatgatgacatgcataatgattcaggatatttc
ttaaaaaataaaattgattctgacgttccgccagacatgaagaatgctgaaggcaatacc
atttcccccagagtatctgctacaaaagaaagaaatctgcacccacaaactataagtgaa
gattgtgttcagaaactggagactaatacttcaccacatgcaaataaagatgtagccatt
gactcatctctgctggattcaaggaattgtaaggtaggctcactcgtgtttattacagct
cattcacaagaaactgtaagaacaaaagagatagtcacagataactgtaataaaatagtc
gagcaaaacagaaagagtaaaccaggcacttgccagacaagctgtcataaagtattggat
gattcaaaggattttatatgtcctagctcttcaggtgatgtctgcataaactcacataag
gataatttttgtcctcataatgaacaaattttacaacataaccaaagtatgtctggactg
aagaaagctgcaacaccacctgttggtttggaaacttgggatacaagtaaatctataaga
gaacctccccaggcagtccatccttcacgcacttatgggatttttagcacagcaagtgga
aaagctgtacaagtgtcagatgcttcattagaaaaggcaaggcaagtgttttctgagatg
gatggtgatgctaaacagttatcttccatggtgtcactggaaggtaatgaaaagtcacat
cactctgtgaaaagagaaaactctgtggtgcacaacacccagggtgtattgtcactccca
aaacccctcccaggcaatgtcaactcatctgtattctctggatttagcactgcaggtgga
aaactggtcacagtttcagaaagtgccttacacaaagttaaaggaatgttagaggagttt
gatttgatcagaactgaacatactctccagcattcacctatacctgaagacgtatcaaaa
atacttcctcaaccttgtgctgaaaacagaaccccagaataccctgtgaactcaaaattg
cagaaaacctacaatgataaatccagcttaccaagtaattataaagaaactggttctttg
ggcaatactcaatctattgaagtttctctccaactctctcagatggggagaaaccaagac
acacggttggtattaggaacaaaagtatcccatagtaaggctaatcttttgggaaaagaa
caaactttaccccaaaacataaaagtaaaaactgatgaaatgaaagcattttctgatgtt
cctgtgaaaacaaatggagaatattactccaaagagtcagagaactattttgaaacagaa
gcagtggagagtgccaaagcttttatggaagatgatgagctgacggattctgaacagact
catgccaaatgctcactgtttacatgcccccaaaatgagactttgtttaatttgagaact
aggaaaagaggagtggctgttgacacagtgggacaacccccaatcaaaagaagcttatta
aatgaatttgacaagataatagaaagtaaaggaaaatccttaacaccttcaaaaagcact
ccagatggcacaataaaagacagaagattgttcacacaccacatgtctctagagccggtt
acctgtggacccttccgctcaagtaaagaaaggcaaggagcccagcacccacatcttacc
tcacctgctcaagggcttctctctaaagggcatccctggagccctttagctttggaaaag
tctccaagcagtcctatagtttcagtcttaccggctcacagcgtttctgtcacaagaacc
gaaaggaccagacattcaggcaaatccaccaaagtcttcgtcccgcctttcaagatgaaa
tcacagtttcacggagatgaacatttcaatagcaagaacgttaatttggaggaaaagaac
caaaagagcacagatggagacaggggagacaggaacgacagccatgatcgtccgtttaac
aaagatttaatgtcaagccttgagagtgccagagaactacaggatatgcgaattaaaaac
aaagaaaggcgacatctccgtccgcagccaggcagtctgtatcttacaaaatcatccact
ctgccccggatctccctgcaggccgcagtaggagacagggctccttctgcatgttctcct
aagcagctctatatatacggcgtttctaaagagtgcataaacgttaatagcaaaaacgct
gagtattttcagtttgacattcaggatcattttggtaaagaagatctgtgtgctggcaaa
ggctttcagttggcagatggtggatggctgatcccctccaatgatggcaaggctggaaaa
gaagaattttatagggctctgtgtgacactccaggtgtggatccaaagcttatttctagc
atctgggtcgctaaccattacaggtggattgtatggaaactggcagctatggaatttgct
tttcctaaggaatttgctaatagatgcctaaacccagaaagagtgctgcttcaactgaaa
tacagatacgatgtggaaattgacaacagcaggagatcggctctaaagaagatactggag
agggatgacacagctgcaaaaacccttgttctctgtatttctgacatcatttcaccaagc
acaaaagtgtctgaaacttcaggcggtaaaactagtggtgaggatgccaacaaagtggac
acgatcgaactcacagatgggtggtacgctgtcagggcccagctagaccctccactcgtg
gctcttgtaaagagtggcaaactgactgtgggtcagaagatcattactcagggagcagag
ctggtgggctctcctgatgcctgtgcacctctggaagccccagactcccttaggctaaag
atttctgcaaacagcacaaggcctgctcgctggcacagcaagctggggttctttcgtgac
cccaggcccttccctctgcccttgtcctcactgttcagtgacggaggaaatgttggctgt
gtggacatcattgttcagagagtgtaccctttacagtgggtggagaagacagtgtctgga
ttgtacatatttcgtagtgagagagaagaggagaaggaagcactgagatttgcagaggcc
cagcagaaaaaactagaggccttgttcaccaaagtccacacagagtttaaagaccccgaa
gaagacacaacacagcggtgtgtgctgtcccgcgcactcacacggcagcaagtccatgct
ctgcaggatggggcagagctctatgcagcagtgcaggatgcatcagacccagatcacctt
gaggcttgtttcagcgaagagcagctaagagccttgaacaactacagacaaatgctgaat
gataagaaacaagcacggatccagtcagaattccgaaaggccctagaatccgctgagaaa
gaagagggtttatcaagggatgttacaactgtgtggaagctgcgggttacaagctacaag
aaaaaggaaaaatcagctctgttgagtatctggcgtccatcatcagacttatcctccctg
ttaacagaaggaaagagatacagaatctatcatcttgcagtgtcaaaatcgaagagtaaa
tttgaacggcccagcatccagttaacagccaccaaaagaactcagtatcaacagctgccg
gtttccagtgagactttactccaggtttaccagcccagggagtcccttcacttcagcaga
ctgtcagacccagcctttcagcctccctgttctgaagtggatgtcgtaggagttgtagtt
tctgttgtaaaaccaataggtcttgctcctttggtctacctgtcagacgagtgccttaat
ttattagtggtgaaattcaggatagaccttaatgaagacataaagccacgtgtgctaatt
gccgcaagcaacctccagtgccagccagaatccacatcaggagtgccgaccttatttgct
ggccatttttccatattttctgccagtccaaaggaggcctactttcaggagaaagtcaac
aacttgaagcatgctattgagaatatcgatacattttacaaggaggcagaaaagaagctt
atacacgtgcttaagggagacagtcccaagtggtccacgccgaacaaaggccccacccga
gaaccccacgcagcctccacttgctgtgcttcagatctcctgggtgcaggaggtcagttc
ctgagaatttcacctactggtcagcaaagttatcaaagtcctttatcacactgcacacca
aaagggaagtctacacccctggctcactcagcccagatggcagcaaagtcttgtggtgga
gagaacgagattgatgacccaaaaacctgtcgaaaaagaagagccttggatttcctaagt
cggctgcccttaccgcccccggtcagtcccatctgtacctttgtctctccagctgcacag
aaggcttttcagccaccacggagctgtggcacgaaatatgcaacacctattaaaaaagag
cccagttccccgcagaggagaacgccatttcagaaggccagtggcgtttctctgccggac
tgtgattcagtagctgatgaagaacttgccttgctcagtacccaagcccttgtgcctgac
tccgtgggaggaaatgaacaagcgtttcccggtgattccacaaggaacccccagccagca
cagaggccagaccagcatgtagggcccaggtccagaaaagagtctctcagggactgtaga
ggcgacagcagtgagaaattagctgttgagtcttag

DBGET integrated database retrieval system