KEGG   Mus caroli (Ryukyu mouse): 110294612
Entry
110294612         CDS       T05910                                 

Gene name
Shh
Definition
(RefSeq) sonic hedgehog protein isoform X1
  KO
K11988  sonic hedgehog
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04340  Hedgehog signaling pathway
mcal04360  Axon guidance
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110294612 (Shh)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110294612 (Shh)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294612 (Shh)
   05205 Proteoglycans in cancer
    110294612 (Shh)
  09162 Cancer: specific types
   05226 Gastric cancer
    110294612 (Shh)
   05217 Basal cell carcinoma
    110294612 (Shh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110294612 (Shh)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110294612 (Shh)
Peptidases and inhibitors [BR:mcal01002]
 Cysteine peptidases
  Family C46: hedgehog family
   110294612 (Shh)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110294612 (Shh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 110294612
NCBI-ProteinID: XP_021018615
Ensembl: MGP_CAROLIEiJ_G0027040
UniProt: A0A6P5PQE8
LinkDB
Position
5
AA seq 438 aa
MLLLLLARCFLVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGA
SGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWP
GVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESK
AHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDF
LTFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDSGPTPGPSALFASRVRPGQ
RVYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTILINRVLASCYAVIEEHSWA
HRAFAPFRLAHALLAALAPARTDGGGGGSLPAAQSAAEVRGAEPTAGIHWYSQLLYHIGT
WLLDSETMHPLGMAVKSS
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgctgctgctgctgctggccagatgttttctggtgatccttgcttcctcgctgctggtg
tgccccgggctggcctgtgggcccggcagggggtttggaaagaggcggcaccccaaaaag
ctgacccctttagcctacaagcagtttattcccaacgtagccgagaagaccctaggggcc
agcggcagatatgaagggaagatcacaagaaactccgaacgatttaaggaactcaccccc
aattacaaccccgacatcatatttaaggatgaggaaaacacaggagcagaccggctgatg
actcagaggtgcaaagacaagttaaatgctttggccatctctgtgatgaaccagtggcct
ggagtgaagctgcgagtgaccgagggctgggatgaggacggccatcattcagaggagtct
ctacactatgaaggtcgagcagtggacatcaccacgtccgaccgggaccgcagcaagtac
ggcatgctggctcgcctggctgtggaagcaggtttcgactgggtctactatgaatccaaa
gctcacatccactgttctgtgaaagcagagaactccgtggcggccaaatccggcggctgt
ttcccgggatccgccacagtgcacctggagcagggcggcaccaagctggtgaaggactta
cgtcccggagaccgcgtgctggcggctgacgaccagggccggctgctgtacagcgacttc
ctcaccttcctggaccgcgacgaaggcgccaagaaggtcttctacgtgatcgagacgctg
gagccgcgcgaacgcctgctgctcaccgccgcgcacctgctcttcgtggcgccgcacaac
gactcggggcccacgcccgggccaagcgcgctctttgccagccgcgtgcgcccgggacag
cgcgtgtacgtggtggctgaacgcggcggggaccgccggctgctgcccgccgcggtgcac
agcgtgacgctgcgagaggaggaggcgggcgcgtacgcgccgctcacagcgcacggcacc
attctcatcaaccgggtgctcgcctcgtgctacgctgtcatcgaggagcacagctgggca
caccgggccttcgcgcctttccgcctggcgcacgcgctgctggccgcgctggcacccgcc
cgcacggacggcgggggcgggggcagcctccctgcagcgcaatctgcagcggaagtgagg
ggcgcggagccgactgcgggcatccactggtactcgcagctgctctaccacattggcacc
tggctgttggacagcgagaccatgcatcccttgggaatggcggtcaagtccagctga

DBGET integrated database retrieval system