KEGG   Mus caroli (Ryukyu mouse): 110294651
Entry
110294651         CDS       T05910                                 

Gene name
Pdgfa
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04630  JAK-STAT signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05231  Choline metabolism in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110294651 (Pdgfa)
   04014 Ras signaling pathway
    110294651 (Pdgfa)
   04015 Rap1 signaling pathway
    110294651 (Pdgfa)
   04630 JAK-STAT signaling pathway
    110294651 (Pdgfa)
   04020 Calcium signaling pathway
    110294651 (Pdgfa)
   04072 Phospholipase D signaling pathway
    110294651 (Pdgfa)
   04151 PI3K-Akt signaling pathway
    110294651 (Pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110294651 (Pdgfa)
   04540 Gap junction
    110294651 (Pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110294651 (Pdgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294651 (Pdgfa)
   05202 Transcriptional misregulation in cancer
    110294651 (Pdgfa)
   05206 MicroRNAs in cancer
    110294651 (Pdgfa)
   05231 Choline metabolism in cancer
    110294651 (Pdgfa)
  09162 Cancer: specific types
   05214 Glioma
    110294651 (Pdgfa)
   05218 Melanoma
    110294651 (Pdgfa)
   05215 Prostate cancer
    110294651 (Pdgfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110294651 (Pdgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110294651 (Pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110294651 (Pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110294651 (Pdgfa)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110294651 (Pdgfa)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110294651 (Pdgfa)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 110294651
NCBI-ProteinID: XP_021018677
Ensembl: MGP_CAROLIEiJ_G0027923
UniProt: A0A6P5PQK1
LinkDB
Position
5
AA seq 211 aa
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGAEDALE
TSLRAHGSHAINHVPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACA
TSNLNPDHREEETGRRRESGKKRKRKRLKPT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagataccccgggagttgatcgagcggctggctcgaagtcagatccacagc
atccgggacctccagcgactcttggagatagactccgtaggggctgaggatgccttggag
acaagcctgagagcccatgggtcccatgccattaaccatgtgcccgagaagcggcctgtg
cccattcgcaggaagagaagtattgaggaagccattcccgcagtttgcaagaccaggacg
gtcatttacgagatacctcggagccaggtggaccccacatcggccaacttcctgatctgg
cccccatgtgtggaggtgaagcgctgcactggctgttgtaacaccagcagcgtcaagtgc
caaccttcacgggtccaccaccgcagtgtcaaggtggccaaagtggagtatgtcaggaag
aagccaaaattgaaagaggtccaggtgaggttagaggaacacctggagtgtgcatgtgcg
acctccaacctgaacccagaccatcgggaggaggagacgggaaggcgtagggaatcaggt
aaaaagcggaaaaggaaaaggttaaaacccacctaa

DBGET integrated database retrieval system