KEGG   Mus caroli (Ryukyu mouse): 110294693
Entry
110294693         CDS       T05910                                 

Gene name
Kit
Definition
(RefSeq) mast/stem cell growth factor receptor Kit isoform X1
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04640  Hematopoietic cell lineage
mcal04916  Melanogenesis
mcal05200  Pathways in cancer
mcal05221  Acute myeloid leukemia
mcal05224  Breast cancer
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110294693 (Kit)
   04014 Ras signaling pathway
    110294693 (Kit)
   04015 Rap1 signaling pathway
    110294693 (Kit)
   04072 Phospholipase D signaling pathway
    110294693 (Kit)
   04151 PI3K-Akt signaling pathway
    110294693 (Kit)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110294693 (Kit)
  09152 Endocrine system
   04916 Melanogenesis
    110294693 (Kit)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294693 (Kit)
   05230 Central carbon metabolism in cancer
    110294693 (Kit)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110294693 (Kit)
   05224 Breast cancer
    110294693 (Kit)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110294693 (Kit)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110294693 (Kit)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110294693 (Kit)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110294693 (Kit)
CD molecules [BR:mcal04090]
 Proteins
  110294693 (Kit)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Ig_6 Ig_4 V-set APH DUF2039 Pkinase_fungal UPF0220 C1-set
Other DBs
NCBI-GeneID: 110294693
NCBI-ProteinID: XP_021018749
Ensembl: MGP_CAROLIEiJ_G0027310
UniProt: A0A6P5PRW6
LinkDB
Position
5
AA seq 979 aa
MRGARGAWDLLCVLLVLLRGQTATSQPSVSPGEPSPPSIHPAQSELIVEAGDTLSLTCVD
PNFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNRNGLTSSIYVFVRDPAKLFL
VGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAY
HRLCVRCAAQREGTWLHSDKFTLKVRAAIKAIPVVSVPETRHLLKKGDTFTVVCTIKDVS
TSVNSMWLKMNPQPQNIAQVKQNSWHRGDFNYERQETLTISSARVNDSGVFMCYANNTFG
SANVTTTLKVVDKGFINIFPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSTN
KGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILT
YDRLMNGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSASPFGKLVVQSS
IDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIHAHTLFTPLLIGFVVAAGAMG
IIVMVLTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGA
GAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLL
GACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEPAEVALYKNLLHSKEPSCDSS
NEYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLEDLLSFSYQVAK
GMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAP
ESIFSCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMVSPEHAPAE
MYDVMKTCWDADPLKRPTFKQVVQLIEKQISDSTKHIYSNLANCNPNPENPVVVDHSVRV
NSVGSSASSTQPLLVHEDA
NT seq 2940 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggatctgctctgcgtcctgttggtcctgctccgtggc
cagacagccacgtctcagccatctgtgagtccaggggagccgtctccgccatccatccat
ccagcgcaatcagagttaatagttgaagctggcgacaccctcagcctgacgtgcgttgat
cccaactttgtcagatggactttcaagacctatttcaatgaaatggttgagaataaaaaa
aatgaatggatccaggaaaaagccgaggccactcgcacgggcacatacacatgcagcaac
agaaatggcctcacgagttctatttacgtgtttgttagagatcctgccaaacttttcctg
gttggccttcccttgtttggcaaagaagacagcgacgcgctggtccgctgccctctgaca
gacccacaggtgtccaattattccctcatcgagtgtgatgggaaatctctccccacggac
ctgacgtttgtcccaaaccccaaggctggcatcaccatcaaaaacgtgaagcgtgcctac
caccggctgtgtgtccgctgtgctgctcagcgtgagggtacatggctgcattctgacaaa
ttcaccctcaaagtgagggcagccatcaaggctatccctgttgtgtctgtgcctgaaaca
agacacctccttaagaaaggggacacatttacggtggtgtgcaccataaaagatgtgtct
acgtccgtgaactccatgtggctaaagatgaaccctcagcctcagaacatagcccaggta
aagcagaatagctggcatcggggtgacttcaattacgaacgccaggagacgctgactatc
agctcagcaagagttaacgattctggagtgttcatgtgttatgccaataatacttttgga
tcagcaaatgtcacaacaaccttgaaagtagtagataaaggattcatcaacatcttccct
gtgaagaacactacagtatttgtcaccgatggagaaaacgtagatttggttgttgaatac
gaggcctatcccaaacccgagcaccagcagtggatatatatgaacaggacctcgactaac
aaagggaaggattatgtcaaatctgataacaaaagtaacatcagatatgtgaaccaactt
cgcctgaccagattaaaaggcacagaaggaggcacttacacctttctggtgtccaactct
gatgccagtgcttccgtgacattcaacgtttacgtgaacacaaaaccagaaatcctgacg
tacgacaggctcatgaatggcatgctccagtgtgtggcagagggattcccggagcccaca
atagattggtatttttgtacaggggcagagcaaaggtgtaccactcctgtctcaccagtg
gacgtacaggtccagaatgtatctgcgtcaccatttggaaaactggtggttcagagttcc
atagactccagcgtcttccggcacaacggcacggtggagtgtaaggcctccaacgatgtg
ggcaagagttccgccttctttaactttgcatttaaaggtaacaacaaagagcaaatccat
gcccacaccctgttcacgccgctgctcattggctttgtggtcgcagctggcgccatgggg
atcattgtgatggttctcacctacaaatatttgcagaagcccatgtatgaagtacaatgg
aaggttgtcgaggagataaatggaaacaattatgtttacatagacccgacgcaacttcct
tatgatcacaaatgggagtttcccagaaacaggctgagttttggaaagacactgggagct
ggtgccttcgggaaggtcgttgaggccactgcttatggcttgattaagtcggatgctgcc
atgacagttgccgtgaagatgctcaaaccaagtgcccatttaacagaaagagaggccctt
atgtcggaactgaaggtcctaagctacctgggcaatcacatgaatattgtgaacctgctt
ggagcatgcacggtgggagggcccaccctggtcattacagaatattgttgctatggtgat
cttttgaattttttgagaaggaaacgtgattcgtttattttctcaaagcaagaagaaccg
gcagaagtggcactttataagaaccttctgcattcaaaggagccttcctgtgacagttca
aatgaatatatggacatgaagcccggcgtttcctacgtcgtgccaaccaagacagacaag
aggagatccgcaagaatagactcgtacatagaaagagacgtgactcctgccatcatggaa
gatgacgagctggctctggacctggaagatttgctgagcttctcctaccaggtggccaag
ggcatggcgttcctcgcctccaagaactgtattcacagagatttggcagccaggaatatc
ctcctcactcacgggcggatcacaaagatttgcgatttcgggctagccagagacatcagg
aatgattcgaattacgtggtcaaaggaaacgcacgactgcccgtgaagtggatggcacca
gagagcattttcagctgcgtgtacacctttgaaagtgatgtctggtcctatgggattttc
ctctgggagctcttttccttaggaagcagcccctacccagggatgccggtcgactccaag
ttttacaagatgatcaaggaaggcttccggatggtcagcccggagcacgcgcctgccgaa
atgtatgacgtcatgaagacttgctgggacgctgaccccttgaaaaggccaacgttcaag
caggttgtccaacttattgagaagcagatctcggacagcaccaagcacatttactccaac
ttggcaaactgcaaccccaacccagagaaccccgtggtggtggaccattccgtgagggtc
aactcggtcggcagcagcgcctcttctacgcagcctctgctcgtgcacgaagatgcctga

DBGET integrated database retrieval system