KEGG   Mus caroli (Ryukyu mouse): 110295092
Entry
110295092         CDS       T05910                                 

Gene name
Gna12
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295092 (Gna12)
   04072 Phospholipase D signaling pathway
    110295092 (Gna12)
   04071 Sphingolipid signaling pathway
    110295092 (Gna12)
   04022 cGMP-PKG signaling pathway
    110295092 (Gna12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110295092 (Gna12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110295092 (Gna12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110295092 (Gna12)
  09156 Nervous system
   04730 Long-term depression
    110295092 (Gna12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295092 (Gna12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110295092 (Gna12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110295092 (Gna12)
   04031 GTP-binding proteins [BR:mcal04031]
    110295092 (Gna12)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   110295092 (Gna12)
GTP-binding proteins [BR:mcal04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    110295092 (Gna12)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 110295092
NCBI-ProteinID: XP_021019223
Ensembl: MGP_CAROLIEiJ_G0027956
UniProt: A0A6P5PSX5
LinkDB
Position
5
AA seq 379 aa
MSGVVRTLSRCLLPAEAGARERRAGAARDAEREARRRSRDIDALLARERRAVRRLVKILL
LGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHS
ENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYF
LDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCF
DGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLV
EKVKSVSIKKHFPDFKGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENIRFV
FHAVKDTILQENLKDIMLQ
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtccggggtggtgcggaccctcagccgctgcttgctgccggccgaggccggagcccgc
gagcgcagggcgggcgcggcgcgcgacgcggagcgcgaggcccgacggcgcagccgcgac
atcgacgcgctgctggcccgcgagcggcgcgcggtgcggcggctggtcaagatcctgctg
ctgggcgccggcgagagcggcaagtccaccttcctcaagcagatgcgcatcatccacggc
cgggagttcgaccagaaggcgctgctggagttccgcgacaccatcttcgacaacatcctt
aagggttcgagggtgcttgtggacgctcgagacaagctcggcattccctggcagcactct
gagaacgagaagcacgggatgtttctgatggccttcgagaacaaggcagggctgcctgtg
gagcctgccaccttccagctctacgtgccagccctgagcgccctctggagagactcgggg
atcagggaagccttcagccgcagaagcgagttccagctgggtgaatcagtgaagtacttc
ctggataacttggaccggattggccagctgaactacttccccagtaagcaagacatcctg
ctggctagaaaggccaccaagggaatcgtggaacatgacttcgttataaagaaaatccca
tttaagatggtggatgtgggcggccagaggtcacagcgccagaagtggttccagtgcttc
gacgggatcacctctatcctgttcatggtgtcctcgagcgagtacgaccaggtcctcatg
gaggacaggcgcaccaaccgcctggtggagtccatgaacatcttcgagaccattgtcaac
aacaagctcttcttcaacgtctccatcatcctcttcctcaacaagatggacctcctggtg
gagaaggtgaagtctgtgagcattaagaagcacttcccagatttcaagggtgaccctcac
cggctggaggacgtccagcgctacctggtgcagtgcttcgacaggaagcgcaggaaccgc
agcaagcccctgttccaccacttcaccaccgccatagacaccgagaacatccgcttcgtg
tttcatgctgtgaaggacacgatcctgcaggagaacctgaaggacatcatgctgcagtga

KEGG   Mus caroli (Ryukyu mouse): 110304818
Entry
110304818         CDS       T05910                                 

Gene name
Gna13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04611  Platelet activation
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110304818 (Gna13)
   04072 Phospholipase D signaling pathway
    110304818 (Gna13)
   04071 Sphingolipid signaling pathway
    110304818 (Gna13)
   04022 cGMP-PKG signaling pathway
    110304818 (Gna13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110304818 (Gna13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110304818 (Gna13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110304818 (Gna13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110304818 (Gna13)
  09156 Nervous system
   04730 Long-term depression
    110304818 (Gna13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304818 (Gna13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110304818 (Gna13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110304818 (Gna13)
   04031 GTP-binding proteins [BR:mcal04031]
    110304818 (Gna13)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110304818 (Gna13)
  Exosomal proteins of colorectal cancer cells
   110304818 (Gna13)
GTP-binding proteins [BR:mcal04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    110304818 (Gna13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 110304818
NCBI-ProteinID: XP_021032088
Ensembl: MGP_CAROLIEiJ_G0017347
UniProt: A0A6P5QFW5
LinkDB
Position
11
AA seq 377 aa
MADFLPSRSVLSVCFPGCVLTNGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDDKNQLHGD
KLMAFDTRAPMAAQGMVETRVFLQYLPAIRALWEDSGIQNAYDRRREFQLGESVKYFLDN
LDKLGVPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
RVVSIKDYFLEFEGDPHCLRDVQKFLVECFRGKRRDQQQRPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcgctccgtgctgtccgtgtgcttcccgggctgcgtgctg
acgaacggcgaggccgagcagcagcgcaagtccaaggagatcgacaaatgcctgtcgcgg
gagaagacctacgtgaagcggctggtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacggccaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggtg
gatgcccgggagaagcttcatatcccctggggagacgacaaaaaccagctccacggagac
aagttgatggcatttgatacccgcgcccccatggctgcccaggggatggtggagactcga
gtgttcctgcagtatcttcctgctatcagagccttatgggaggacagtggtatacagaac
gcctacgatcggcgccgggaattccagctgggtgagtctgtaaagtatttcttggataac
ttggataaacttggagtaccggattacattccgtcacagcaagatatcctgcttgccaga
aggcccaccaaaggcatccatgagtacgactttgaaattaaaaatgttcctttcaaaatg
gttgacgtaggtggccagagatccgaacggaaacgctggtttgaatgctttgacagtgtg
acgtcgatactcttccttgtctcttcaagtgaatttgaccaggtgctaatggaggaccgc
cagaccaatcgccttacagagtctctgaacatttttgaaacaatcgtcaataatcgggtt
ttcagcaatgtgtccataatcctcttcttaaacaagacagacttgctcgaggagaaagtg
cgagtggtcagcatcaaagactatttcctagaatttgaaggggacccacactgcttaaga
gacgtccaaaagtttctggtggaatgcttccgggggaaacgccgggaccagcagcagagg
ccgttgtaccaccacttcaccaccgcgatcaacacagagaacatccgcctcgtgttccgg
gacgtgaaggacacgatccttcatgacaacctgaagcagctcatgctgcagtga

DBGET integrated database retrieval system