KEGG   Mus caroli (Ryukyu mouse): 110295101
Entry
110295101         CDS       T05910                                 

Gene name
Abcb1
Definition
(RefSeq) multidrug resistance protein 1 isoform X1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal02010  ABC transporters
mcal04976  Bile secretion
mcal05206  MicroRNAs in cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    110295101 (Abcb1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    110295101 (Abcb1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110295101 (Abcb1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110295101 (Abcb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110295101 (Abcb1)
   04147 Exosome [BR:mcal04147]
    110295101 (Abcb1)
   04090 CD molecules [BR:mcal04090]
    110295101 (Abcb1)
Enzymes [BR:mcal01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     110295101 (Abcb1)
Transporters [BR:mcal02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    110295101 (Abcb1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110295101 (Abcb1)
CD molecules [BR:mcal04090]
 Proteins
  110295101 (Abcb1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 AAA_22 RsgA_GTPase Zeta_toxin G-alpha AAA Rad17 AAA_29 AAA_5 APS_kinase AAA_7 AAA_15 PRK NTPase_1 DUF2207 ATP-synt_ab
Other DBs
NCBI-GeneID: 110295101
NCBI-ProteinID: XP_021019236
Ensembl: MGP_CAROLIEiJ_G0026959
UniProt: A0A6P5PSY8
LinkDB
Position
5
AA seq 1276 aa
MELEEDFKGRTDKNFSKMGKKSKKEKKEKKPAVSVLTMFRYAGWLDRLYMLVGTLAAIIH
GVALPLMMLIFGDMTDSFANVGNFSKNNTNTSDADKRAMFAKLEDEMTTYAYYYTGIGAG
VLIVAYIQVSFWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINE
GIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKEL
HAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFL
LIYASYALAFWYGTSLVISREYTIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYE
VFKIIDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVA
LVGNSGXGKSTTVQLMQRLYDPLEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTI
AENIRYGREDVTMXEIEKAVKEANAYDFIMKLPQQFDTLVGERGAQLSGGQKQRIAIARA
LVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGG
VIVEQGNHDELMREKGIYFKLVMTQTAGNEIELGNEACKSKDEIDNLDMSSKDSGSSLIR
RRSTRKSICGPHDQDRKLSTKEALDEDVPPASFWRILKLNSTEWPYFVVGIFCAIINGGL
QPAFSVIFSKVVGVFTNGGPPETQQQNSNLFSLLFLVLGIISFITFFLQGFTFGKAGEIL
TKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVISQNIANLG
TGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENF
RTVVSLTREQKFETMYAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLV
AQQLMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKATVSASHIIRIIEKIPEIDSYSTK
GLKPNMLEGNVQFSGVMFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLE
RFYNPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSHEE
IVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATS
ALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQK
GIYFSMVSVQAGAKRS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atggaacttgaagaggactttaagggaagaacagacaagaacttctcaaagatgggcaaa
aagagtaaaaaggagaagaaagaaaagaaaccagcagtcagtgtgcttacaatgtttcgt
tatgcaggttggctggacaggttgtacatgctggtgggaactctggctgctattatccat
ggagtggcactcccacttatgatgctgatctttggcgacatgacagatagctttgcaaat
gtaggaaacttctctaaaaacaatactaatacaagtgatgccgataaaagagccatgttt
gccaaactggaggatgaaatgaccacgtacgcctactattacaccgggattggtgctggt
gtgctcatagttgcctacatccaggtttcattttggtgcctggcagctggaagacagata
cacaagattaggcagaagttttttcatgctataatgaatcaggagataggctggtttgac
gtgcatgacgttggggagctcaacacccggctcacagatgatgtttccaaaattaatgaa
ggaattggtgacaaaattggaatgttcttccaggcaatggcaacattttttggtggtttt
ataataggatttacccgtggctggaagctaacccttgtgattttggccatcagccctgtt
cttggactgtcagctggtatttgggcaaagatattgtcttcatttactgataaggaactc
catgcttatgcaaaagctggagcagttgctgaagaagtcttagcagccatcagaactgtg
attgcctttggaggacaaaagaaggaacttgaaaggtacaataacaatttggaagaagct
aaaaggctggggataaagaaagctatcacggccaacatctctatgggtgcagcttttctt
cttatctatgcatcatatgctctggcattctggtatgggacttccttggtcatctcccgt
gaatacactattggacaagtgctcactgtcttcttttctgtgttaattggagcatttagt
gttggacaggcatctccaaatattgaagccttcgccaatgctcgaggagcagcttatgaa
gtcttcaaaataattgataataagcccagtatagacagcttctcaaagagtgggcacaaa
ccagacaacatacaaggaaatctggaattcaagaatattcacttcagttacccatctcga
aaagaagttcagatcttgaagggcctcaatctgaaggtgaagagcggacagacggtggcc
ctggttggcaacagtggctgnggaaaaagcacaactgtccagctgatgcagaggctctac
gaccccctagagggcgtggtcagtatcgacggacaggacatcagaaccatcaatgtgagg
tatctgagggaaatcattggtgtggtgagtcaggaacctgtgctgtttgccaccacgatc
gctgagaacattcgctatggccgagaagatgtcaccatggntgagattgagaaagctgtc
aaggaagccaatgcctatgacttcatcatgaaactgccccaacaatttgacaccctggtt
ggtgagagaggggcgcagctgagtgggggacagaaacagagaatcgccatcgcccgggcc
ctggtccgcaaccccaagatccttttgttggacgaggccacctcagccctggatacagaa
agtgaagctgtggttcaggccgcactggataaggctagagaaggccggaccaccattgtg
atagctcatcgcttgtctacagttcgtaatgctgacgtcattgctggttttgatggtggt
gtcattgtggagcaaggaaatcatgatgagctcatgagagaaaagggcatttacttcaaa
cttgtcatgacacagacagcaggaaatgaaattgaattaggaaatgaagcttgtaaatct
aaggatgaaattgataatttagacatgtcttcaaaagattcaggatccagtctaataaga
agaagatcaactcgcaaaagcatctgtggaccacatgaccaagacaggaagcttagtacc
aaagaggccctggatgaagatgtacctccagcttccttttggcgaatcctgaagttgaat
tcaactgaatggccttattttgtggttggtatattttgtgccataataaatggaggctta
cagccagcattctccgtaatattttcaaaagttgtaggggtttttacaaacggtggcccc
cctgaaacccagcagcagaacagcaacttgttttccttgttgtttctggtccttgggatc
atttctttcattacattttttcttcagggcttcacatttggcaaagctggagagatcctc
actaagcgactccgatacatggttttcaaatccatgctgagacaggatgtgagctggttt
gatgaccctaaaaacaccaccggagcactgaccactaggctcgccaacgatgctgctcaa
gtgaaaggggctacagggtctaggcttgctgtgatttcccagaacatagcaaatcttggg
acaggaatcatcatatccctaatctacggctggcaactgacacttttactcttagcaatt
gtacccatcatcgcgatagcaggagtggttgagatgaaaatgttgtctggacaagcactg
aaagataagaaggaactagaaggttctggaaagattgctacggaagccattgaaaacttc
cgcactgtcgtctctttgactcgggagcagaagtttgaaaccatgtatgcccagagcttg
cagataccatacagaaatgcgatgaagaaagcacacgtgtttgggatcacgttctccttc
acccaggccatgatgtatttttcttatgctgcttgtttccggttcggtgcctacttggtg
gcacaacaactcatgacttttgaaaatgttctgttagtattctcagctattgtctttggt
gccatggcagtggggcaggtcagttcattcgctcctgactatgcgaaagccacagtgtca
gcatcccacatcatcaggatcatcgagaaaatccccgagattgacagctatagcacgaaa
ggcctaaagcctaatatgttggaaggaaatgtgcaatttagtggagtcatgttcaattat
cccacccgacccaacatcccagtgcttcagggactgagcctcgaagtgaagaagggccag
acgctggccctggtgggcagcagtggctgtgggaagagcacagtggtccagctgcttgag
cgcttctacaaccccatggctggatcagtgtttctagatggcaaagaaataaagcaactg
aatgtccagtggctccgagctcaactgggcattgtgtcccaggagcccattctctttgac
tgcagcatcgcagagaacatcgcctacggagacaacagccgggtcgtgtctcatgaggag
attgtgagggcagccaaggaggccaacatccaccagttcatcgactcgctgcctgataaa
tacaacaccagagtaggagacaaaggcactcagctgtcgggtgggcagaagcagcgcatc
gccatcgcgcgcgccctcgtcagacagcctcacattttacttctggacgaagcaacatca
gctctggatacagaaagtgaaaaggttgtccaggaagcactagacaaagccagggaaggc
cgcacctgcattgtgatcgctcaccgcctgtccaccatccagaacgcagacttgatcgtg
gtgattcagaacggcaaggtcaaggagcacggcacccaccagcagctgctggcacagaag
ggcatctatttctcaatggtcagtgtgcaggctggagcaaagcgctcatga

DBGET integrated database retrieval system