KEGG   Mus caroli (Ryukyu mouse): 110295292
Entry
110295292         CDS       T05910                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04144  Endocytosis
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04630  JAK-STAT signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295292 (Pdgfra)
   04014 Ras signaling pathway
    110295292 (Pdgfra)
   04015 Rap1 signaling pathway
    110295292 (Pdgfra)
   04630 JAK-STAT signaling pathway
    110295292 (Pdgfra)
   04020 Calcium signaling pathway
    110295292 (Pdgfra)
   04072 Phospholipase D signaling pathway
    110295292 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    110295292 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110295292 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110295292 (Pdgfra)
   04540 Gap junction
    110295292 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110295292 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295292 (Pdgfra)
   05206 MicroRNAs in cancer
    110295292 (Pdgfra)
   05230 Central carbon metabolism in cancer
    110295292 (Pdgfra)
   05231 Choline metabolism in cancer
    110295292 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    110295292 (Pdgfra)
   05218 Melanoma
    110295292 (Pdgfra)
   05215 Prostate cancer
    110295292 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110295292 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110295292 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110295292 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110295292 (Pdgfra)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110295292 (Pdgfra)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110295292 (Pdgfra)
CD molecules [BR:mcal04090]
 Proteins
  110295292 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set ig Ig_2 Pkinase V-set Herpes_gE C2-set_2 C1-set
Other DBs
NCBI-GeneID: 110295292
NCBI-ProteinID: XP_021019454
Ensembl: MGP_CAROLIEiJ_G0027309
LinkDB
Position
5
AA seq 790 aa
MGTSHQVFLVLSCLLTGPGLISCQLLLPSILPNENEKIVQLNSSFSLRCVGESEVSWQHP
MSEEDDPNVEIRNEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAVIPCRTTDPETQVTLHKNGRLVPASYDSRQGFNG
TFSVGPYICEATVKGRTFKTSEFNVYALKATSELNLEMDARQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIEPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYQSKLKLIRAKEEDSGHYTIIVQNEDDVKSYTFELSTLVPASILDL
VDDHHGSGGGQTVRCTAEGTPLPDIDWMICKHIKKCNNDTSWTVLASNVSNIITELPRRG
RSTVEGRVYFAKVEETIAVRCLAKNNLSVVARELKLVAPTLRSELTVAAAVLVLLVVVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKPKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLGKSARA
HSGKYDLSVV
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggggacctcccaccaggtctttctggtcctcagctgtctcctcacagggccgggcctc
atctcctgccagctcttattaccctctatcctcccaaatgagaatgagaagattgtgcag
ctgaattcgtccttttctctgagatgcgttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagacgaccccaacgtggaaatcagaaatgaggagaacaacagtggcctc
tttgtcacagtgctggaagtggtcaacgcctctgccgcccacaccggatggtacacttgc
tactacaaccacactcagacggatgagagtgagatcgaaggcaggcacatttacatctat
gtaccagacccagacatggcctttgtgcctctcgggatgacagattctttagtcatcgtg
gaggaggatgattctgctgtcataccttgccgcaccacagatccggaaactcaagtaacc
ttgcacaagaacgggaggctggtgcctgcctcctatgacagcaggcagggcttcaacggg
accttcagcgtggggccttacatctgtgaggccaccgtcaaagggaggacgttcaagacc
agcgagtttaacgtttatgccttgaaagcaacgtcagaactgaatctggagatggacgca
cgccagactgtgtataaggcaggagaaactatcgtggtgacctgtgctgtctttaacaac
gaggtcgttgacctgcagtggacttaccctggagaagtgagaaacaaaggtatcaccatg
ctggaggagatcaaactcccgtccatcaaactggtgtacactttgaccgtccccaaggcc
acggtgaaggacagtggagagtatgaatgcgctgcccgtcaggccactaaagaggtcaag
gaaatgaagagagtcaccatttctgtccacgagaaaggcttcgtcgagatcgagcccacc
tttggccagctggaagctgtcaacttgcatgaagtcagagagttcgtggtggaggtgcag
gcctacccgacacccaggatatcatggctgaaggacaacttgactctgatagagaatctc
accgagatcaccaccgacgtacagaagagtcaggaaacaaggtatcaaagcaaattaaag
ctgattcgggctaaggaagaagacagtggccattacaccattatagttcaaaatgaggat
gacgtgaagagttacacgtttgagctgtcaaccctagttcctgcatccattctggacctc
gtagatgaccaccatggctctggcgggggacagactgtgaggtgcacagccgaaggcacc
cctcttccggacatcgactggatgatctgcaagcatattaagaaatgtaataatgacact
tcgtggacagttttggccagcaatgtctcgaatattatcacagagctccctcgccgcggc
aggagtaccgtggagggacgagtgtacttcgccaaagtggaagagaccatcgcagttcga
tgcctggcaaagaacaacctcagcgttgtggcccgtgagctgaagctggtggctcccacc
ctgcgatctgaactcacagtggcggccgcagtgctggtgctgttggtggttgtcattgtg
tctctcatcgtcctggtggtcatttggaagcagaaaccacggtatgaaattcgctggagg
gttatcgagtcaatcagccccgatggacatgagtatatctatgtggaccccatgcagttg
ccttatgactccagatgggaattcccgagagatggcctcgtgcttggtcggatcttggga
tccggtgcatttgggaaagtggttgaaggcacagcttatggattaagccggtcccaacct
gtaatgaaggtggctgtgaagatgctcaaacccacagccaggtctagcgaaaagcaggct
ctcatgtccgagctgaagataatgactcacctggggccgcatttgaatattgtgaacttg
ctgggagcctgcaccaagtcaggtcccatttacatcatcacagaatactgcttctatggg
gatttggtcaactacttacataagaacagagatagcttcatgagccaacacccagagaag
ccgaagaaagacctggacatctttggattgaatcctgcagacgagagcacaagaagttat
gtgattttgtcttttgaaaataatggcgactacatggacatgaagcaagctgataccaca
caatatgtccccatgcttgaaaggaaagaggtttctaaatactctgacatccagagatcg
ctgtacgatcggccagcctcctacaagaagaaatccatgctaggtaaaagcgcccgtgct
cattctggcaaatatgatctttctgtggtttaa

DBGET integrated database retrieval system