KEGG   Mus caroli (Ryukyu mouse): 110295295Help
Entry
110295295         CDS       T05910                                 

Gene name
Fip1l1
Definition
(RefSeq) pre-mRNA 3'-end-processing factor FIP1 isoform X1
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110295295 (Fip1l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110295295 (Fip1l1)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     110295295 (Fip1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fip1
Motif
Other DBs
NCBI-GeneID: 110295295
NCBI-ProteinID: XP_021019463
Ensembl: MGP_CAROLIEiJ_G0027304
LinkDB All DBs
Position
5
AA seq 604 aa AA seqDB search
MSAGEVERLVELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANPP
SGIEEEAAENGVAKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNLN
IKAGGRVYGNTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFN
EDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGRT
GNSEKEAALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKASSSVGKWQDRYGR
AESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSDRSATEVDNNFSKPPPFFP
PGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGIPITVPPPGFPPPPGAPPPSLIPTIESGH
SSGYDSRSARAFPYGNVAFPHLTSSAPSWPSLVDTTKQWDYYARREKDRDRDRERDRDRE
RERDRDRERERTRERERERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRE
RRHREKEETRHKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPVPEQESTEA
APAE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccggcgaggtggagcgcctggtggagctgagcggcgggaccggaggggatgag
gaggaagagtggctgtatggcggcccgtgggacgtgcatgtgcacagtgacttggcaaag
gatctagatgagaatgaagttgaaaggccagaagaagaaaatgccagtgctaatcctcca
tctggaattgaagaagaagctgctgaaaatggcgtggcaaaaccgaaagtgacagagact
gaagacgacagtgatagtgacagtgacgatgatgaagatgacgttcacgtcactatagga
gacatcaaaacgggagcaccacagtatgggagttatggaacagcaccagtaaatcttaat
atcaaagcagggggaagagtttatggaaatacaggaaccaaagtcaaaggagtggacctc
gatgcacctggcagcattaatggagttccactcttggaggtagatctggattcttttgaa
gataaaccatggcggaaacctggtgctgatctttctgattattttaactatggctttaat
gaagatacttggaaagcttactgtgaaaaacaaaagaggatacgaatgggactggaagtt
atacctgttacttcaaccacaaacaagattacggccgaagactgtactatggaagttaca
ccaggtgcagagatccaagatggcagattcaatctttttaaggtacagcaagggagaact
ggaaattcagagaaagaagcagctcttccatctacaaaagctgagtttacttctccgcca
tcattgttcaagactggtctgccaccaagcagaaacagcacctcttctcagtctcagaca
agtactgcctccagaaaagccagttcaagcgttgggaagtggcaggatcgatatgggagg
gccgagtcacctgatctaaggagattacctggagcaattgatgtcattggtcaaacaata
accatcagccgagtggaaggaagacggcgtgcaaatgagaacagcaatatacaggtcctt
tctgacagatctgccactgaagtagacaacaatttcagcaaaccacctccatttttccct
ccaggggctcctcctactcaccttcctcctcctccatttcttccacctcctccaactgtc
agcaccgccccacctctcattccaccaccaggtattccaataactgtaccacctccaggt
tttccccctccaccaggcgccccacctccatctcttataccaacaatagaaagtggccat
tcctctgggtatgacagccgttctgcacgagcgtttccctatggcaatgtcgcctttccc
caccttaccagttctgctccctcatggcctagccttgtggacaccaccaagcagtgggac
tattatgcacggagagaaaaagaccgagatcgagaccgggagagagaccgagacagagag
cgagagcgggaccgggacagagaaagggaacgcacccgggagcgggagcgagagcgcgac
cacagccccaccccaagtgttttcaacagtgatgaagagcgatacagatacagggagtat
gcagagagaggctatgagcgccatagagctagtcgggagaaagaagagcggcacagagaa
cgacgtcacagagagaaggaggaaacaagacacaagtcctctcgcagtaatagtagacgt
cgccatgaaagtgaagaaggggacagtcacagaagacacaagcacaaaaagtctaaaaga
agtaaagaaggaaaagaggctggcagcgagccagtcccagaacaggagagcaccgaagct
gcccctgccgagtag

DBGET integrated database retrieval system