KEGG   Mus caroli (Ryukyu mouse): 110295322
Entry
110295322         CDS       T05910                                 

Gene name
Pdx1
Definition
(RefSeq) pancreas/duodenum homeobox protein 1
  KO
K07594  insulin promoter factor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04911  Insulin secretion
mcal04930  Type II diabetes mellitus
mcal04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110295322 (Pdx1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110295322 (Pdx1)
   04950 Maturity onset diabetes of the young
    110295322 (Pdx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110295322 (Pdx1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    110295322 (Pdx1)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 110295322
NCBI-ProteinID: XP_021019497
Ensembl: MGP_CAROLIEiJ_G0028036
UniProt: A0A6P5PV46
LinkDB
Position
5
AA seq 284 aa
MNSEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPPPQFASSLGSLEQG
SPPDISPYEVPPLASDDPAGAHLHHHLPAQLGLSHPPPGPFPNGTEPGGLEEPNRVQLPF
PWMKSTKAHAWKGQWAGGAYTAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVEL
AVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTPSGGGGSEEPEQDCAVTSGEELLAVP
PLPPPGGAVPPGVPAAVREGRLPSGLSVSPQTSSIAPLRPQEPR
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaacagtgaggagcagtactacgcggccacacagctctacaaggacccgtgcgcattc
cagaggggcccagtgccagagttcagcgctaacccccctgcgtgcctgtacatgggccgc
cagcccccacctccgccgccaccccagtttgcaagctcgctgggatcactggagcaggga
agtcccccggacatctccccatacgaagtgcccccgctcgcctccgacgacccggctggc
gctcacctccaccaccaccttccagctcagctcgggctctcccatccacctcccggacct
ttcccgaatggaaccgagcctgggggcctggaagagcccaaccgcgtccagctccctttc
ccgtggatgaaatccaccaaagctcacgcgtggaaaggccagtgggcaggaggtgcttac
acagcggaacccgaggagaacaagaggacccgtactgcctacacgcgggcgcagctgctg
gagctggagaaggaattcttatttaacaaatacatctcccggccccgccgggtggagctg
gcagtgatgttgaacttgaccgagagacacatcaaaatctggttccaaaaccgtcgcatg
aagtggaaaaaagaggaagataagaaacgtagtagcgggaccccgagcgggggcggtgga
agcgaagagccggagcaagattgtgcggtgacctcgggcgaggagctgctggcagtgcca
ccgctgccacctcccggaggtgcggtgcccccaggcgtcccagctgcagtccgggagggc
cgactgccttcaggccttagcgtgtcgccacagacctccagcatcgcgccactgcgaccg
caggaaccccggtga

DBGET integrated database retrieval system