KEGG   Mus caroli (Ryukyu mouse): 110295330
Entry
110295330         CDS       T05910                                 

Gene name
Il6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01523  Antifolate resistance
mcal04060  Cytokine-cytokine receptor interaction
mcal04061  Viral protein interaction with cytokine and cytokine receptor
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04218  Cellular senescence
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04640  Hematopoietic cell lineage
mcal04657  IL-17 signaling pathway
mcal04659  Th17 cell differentiation
mcal04668  TNF signaling pathway
mcal04672  Intestinal immune network for IgA production
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05010  Alzheimer disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05134  Legionellosis
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05143  African trypanosomiasis
mcal05144  Malaria
mcal05146  Amoebiasis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05321  Inflammatory bowel disease
mcal05323  Rheumatoid arthritis
mcal05332  Graft-versus-host disease
mcal05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110295330 (Il6)
   04668 TNF signaling pathway
    110295330 (Il6)
   04066 HIF-1 signaling pathway
    110295330 (Il6)
   04068 FoxO signaling pathway
    110295330 (Il6)
   04151 PI3K-Akt signaling pathway
    110295330 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110295330 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110295330 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110295330 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110295330 (Il6)
   04620 Toll-like receptor signaling pathway
    110295330 (Il6)
   04621 NOD-like receptor signaling pathway
    110295330 (Il6)
   04623 Cytosolic DNA-sensing pathway
    110295330 (Il6)
   04625 C-type lectin receptor signaling pathway
    110295330 (Il6)
   04659 Th17 cell differentiation
    110295330 (Il6)
   04657 IL-17 signaling pathway
    110295330 (Il6)
   04672 Intestinal immune network for IgA production
    110295330 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295330 (Il6)
   05202 Transcriptional misregulation in cancer
    110295330 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110295330 (Il6)
   05321 Inflammatory bowel disease
    110295330 (Il6)
   05332 Graft-versus-host disease
    110295330 (Il6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110295330 (Il6)
   05020 Prion disease
    110295330 (Il6)
   05022 Pathways of neurodegeneration - multiple diseases
    110295330 (Il6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110295330 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110295330 (Il6)
   04931 Insulin resistance
    110295330 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110295330 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110295330 (Il6)
   05135 Yersinia infection
    110295330 (Il6)
   05133 Pertussis
    110295330 (Il6)
   05134 Legionellosis
    110295330 (Il6)
   05152 Tuberculosis
    110295330 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110295330 (Il6)
   05161 Hepatitis B
    110295330 (Il6)
   05171 Coronavirus disease - COVID-19
    110295330 (Il6)
   05164 Influenza A
    110295330 (Il6)
   05162 Measles
    110295330 (Il6)
   05168 Herpes simplex virus 1 infection
    110295330 (Il6)
   05163 Human cytomegalovirus infection
    110295330 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110295330 (Il6)
   05169 Epstein-Barr virus infection
    110295330 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110295330 (Il6)
   05144 Malaria
    110295330 (Il6)
   05142 Chagas disease
    110295330 (Il6)
   05143 African trypanosomiasis
    110295330 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110295330 (Il6)
   01523 Antifolate resistance
    110295330 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110295330 (Il6)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interleukins
   110295330 (Il6)
SSDB
Motif
Pfam: IL6 IL23 ELMO_CED12
Other DBs
NCBI-GeneID: 110295330
NCBI-ProteinID: XP_021019503
Ensembl: MGP_CAROLIEiJ_G0027048
UniProt: A0A6P5PTK2
LinkDB
Position
5
AA seq 211 aa
MKFLSARDFHPVGFLGLMLVTTTAFPTPQVRKGDFTEDTTPNRPVYTTSQVGGLITHVLW
EIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEY
HIYLEYMKNNLKDNKKEKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLMDKLES
QKEWLKTKTIQFILKSLEEFLKVTLRSTRQA
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaagttcctttctgcaagagacttccatccagttggcttcttgggactgatgctggtg
acaaccacggccttccctactccacaagtccggaaaggagacttcacagaggataccact
cccaacagacctgtctataccacttcacaagtcggaggcttaattacacatgttctctgg
gaaatcgtggaaatgagaaaagagttgtgcaatggcaattctgattgtatgaacaacgat
gatgcacttgcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgctac
caaactggatacaatcaggaaatttgcctattgaaaatttcctctggtcttctggagtac
catatctacctggagtacatgaagaacaacttaaaagataacaagaaagagaaagccaga
gtccttcagagagatacagaaactctaattcatatcttcaatcaagaggtaaaagattta
cataaaatagtccttcctaccccaatttccaatgctctcctaatggataagctggagtca
cagaaggagtggctaaaaaccaagaccatccaattcatcttgaaatcacttgaagaattt
ctaaaagtcactttgagatctactcggcaagcctag

DBGET integrated database retrieval system