KEGG   Mus caroli (Ryukyu mouse): 110295337
Entry
110295337         CDS       T05910                                 

Gene name
Kl
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00040  Pentose and glucuronate interconversions
mcal00053  Ascorbate and aldarate metabolism
mcal01100  Metabolic pathways
mcal04211  Longevity regulating pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
Module
mcal_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110295337 (Kl)
   00053 Ascorbate and aldarate metabolism
    110295337 (Kl)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110295337 (Kl)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110295337 (Kl)
  09149 Aging
   04211 Longevity regulating pathway
    110295337 (Kl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110295337 (Kl)
   04147 Exosome [BR:mcal04147]
    110295337 (Kl)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     110295337 (Kl)
Transporters [BR:mcal02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   110295337 (Kl)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110295337 (Kl)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 110295337
NCBI-ProteinID: XP_021019509
Ensembl: MGP_CAROLIEiJ_G0028064
UniProt: A0A6P5PN52
LinkDB
Position
5
AA seq 1014 aa
MLARAPPRRPPRLVLLRLLLLHLLLLSLRARCLSAEPGQGAQTWARFARAPAPEAAGLLH
DTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHSGAAPSDSPIVVAPSGAPSPPL
SSTGDVASDSYNNVYRDTEGLRELGVTHYRFSISWARVLPNGTAGTPNREGLRYYRRLLE
RLRELGVQPVVTLYHWDLPQRLQDTYGGWANRALADHFRDYAELCFRHFGGQVKYWITID
NPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGRVSIAL
SSHWINPRRMTDYNIRECQKSLDFVLGWFAKPIFIDGDYPESMKNNLSSLLPDFTESEKR
LIRGTADFFALSFGPTLSFQLLDPNMKFRQLESPNLRQLLSWIDLEYNHPPIFIVENGWF
VSGTTKRDDAKYMYYLKKFIMETLKAIRLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFY
VDFLSQDKELLPKSSALFYQKLIEDNGFPPLPENQPLEGTFPCDFAWGVVDNYVQVDTTL
SQFTDPNVYLWDVHHSKRLIKVDGVVAKKRKTYCADFSAIRPQITLLREMRVTHFRFSLD
WALILPLGNQTQVNHTVLHFYRCMISELVHANITPVVALWQPAALHQGLPHALAKHGAWE
NPHTALAFADYANLCFKELGHWVNLWITMNEPNTRNMTYRAGHHLLRAHALAWHLYDDKF
RAAQKGKISIALQADWIEPACPFSQNDKEVAERVLEFDIGWLAEPIFGSGDYPRVMRDWL
NQKNNFLLPYFTEDEKKLVRGSFDFLAVSHYTTILVDWEKEDPMKYNDYLEVQEMTDITW
LNSPSQVAVVPWGLRKVLNWLRFKYGDLPMYVTANGIDDDPHAEQDSLRIYYIKNYVNEA
LKAYVLDGINLCGYFAYSLSDRSAPKSGFYRYAANQFEPKPSMKHYRKIIDSNGFLGSGT
LGKFCPEEYTVCTECGFFQTRKSLLVFISFLVFTFIISLALIFHYSKKGQRSYK
NT seq 3045 nt   +upstreamnt  +downstreamnt
atgctagcccgcgcccctcctcgccgcccgccgcggctggtgctgctccgtttgctgttg
ctgcatctgctgctgctctccctgcgcgcccgctgcctgagcgctgagccgggtcagggc
gcgcagacctgggctcgcttcgcgcgcgctcctgccccagaggccgctggcctcctccac
gacaccttccccgacggtttcctctgggcggtaggcagcgccgcctatcagaccgagggc
ggctggcgacagcacggcaaaggcgcgtccatctgggacactttcacccatcactctggg
gcggccccgtccgactccccgatcgtcgtggcgccgtcgggtgccccgtcgcctcccctg
tcctctactggagatgtggccagcgatagttacaacaacgtctaccgcgacacagagggg
ctgcgcgaactgggggtcacccactaccgcttctccatatcgtgggcgcgggtgctcccc
aatggcaccgcgggcactcccaaccgcgaggggctgcgctactaccggcggctgctggag
cggctgcgggagctgggcgtgcagccggtggttaccctgtaccattgggacctgccacag
cgcctgcaggacacctatggcggatgggccaatcgcgccctggctgaccatttcagggat
tatgccgagctctgcttccgccacttcggtggtcaggtcaagtactggatcaccattgac
aacccctacgtggtggcctggcacggatatgccaccgggcgcctggccccgggcgtgagg
ggcagctccaggctcgggtacctggttgcccacaacctacttttggctcatgccaaagtc
tggcatctctacaacacctctttccgccccacacagggaggccgggtgtctatcgcctta
agctcccattggatcaatcctcgaagaatgaccgactataacatcagagaatgccagaag
tctcttgactttgtgctaggctggtttgccaaacccatatttatcgatggcgactaccca
gagagtatgaagaacaacctttcgtctcttctgcctgattttactgaatctgagaagagg
ctcatcagaggaactgctgacttttttgctctttccttcggaccaaccttgagctttcag
ctattggaccctaacatgaagttccgccagttggagtctcccaacctgaggcagcttctg
tcttggatagatctggaatataaccaccctccaatatttattgtggaaaatggctggttt
gtctcgggaaccaccaaaagggatgatgccaaatacatgtattatctcaagaagttcata
atggaaaccttaaaagctatcaggctggatggggtcgacgtcattgggtacactgcgtgg
tcgctcatggacggtttcgagtggcataggggttacagcatccggcgaggactcttctac
gttgactttctgagtcaggacaaggagctgttgccaaagtcttcggccttgttctaccaa
aagctgatagaggacaatggctttcctcctttacctgaaaaccagccccttgaagggaca
tttccctgtgactttgcttggggagttgttgacaactacgttcaagtggacactactctc
tctcagtttactgacccgaatgtctatctgtgggatgtgcatcacagtaagaggcttatt
aaagtagatggggttgtagccaagaagagaaaaacttactgtgctgatttctctgccatc
cggcctcagataaccttacttcgagaaatgcgggtcacccactttcgcttctccctggac
tgggccttgatcttgcctctgggtaaccagacccaagtgaaccacacggttctgcacttc
taccgctgcatgatcagtgagctggtgcacgccaacatcactccagtggtggccctgtgg
cagccagcagccctgcaccaaggcctgccacatgcccttgcaaaacatggggcctgggag
aacccgcacactgccctggcgtttgcagactatgcaaacctgtgctttaaagagttgggt
cactgggtcaatctctggatcaccatgaacgagccaaacacacggaacatgacctatcgt
gccgggcaccacctcctgagagcccatgccttggcttggcatctgtacgatgacaagttt
agggcggctcagaaaggcaaaatatccatcgccttgcaggctgactggatagaaccggcc
tgccctttctctcaaaatgacaaagaagtggccgagagggttttggaatttgatataggc
tggctggcagagcctattttcggttccggagattatccacgtgtgatgagggactggctg
aaccaaaaaaacaattttcttttgccctatttcaccgaagatgaaaaaaagctagtccga
ggttcctttgacttcctggcggtgagtcattacaccaccattctggtagactgggaaaag
gaggatccgatgaaatacaacgattacttggaggtgcaggagatgactgacatcacatgg
ctcaactctcccagtcaggtggcagtggtgccttgggggctgcgcaaagtgctcaactgg
ctaaggttcaagtacggagacctcccgatgtatgtgacagccaatggaatcgatgatgat
ccccatgccgagcaagactcactgaggatctattatattaagaattatgtgaatgaggct
ctgaaagcctacgtgttggacggcatcaacctttgtggctactttgcgtattcacttagt
gatcgctcagctcccaagtctggcttttatcgatatgctgcgaatcagtttgagcccaaa
ccatctatgaaacattacaggaaaattattgacagcaatggcttcctgggttctggaaca
ctgggaaagttttgtccggaagaatacactgtgtgcaccgaatgtggattttttcaaact
cggaagtctttgctggtcttcatctcgtttcttgtttttacttttattatttctcttgct
ctcatttttcactactccaagaaaggccagagaagttataagtaa

DBGET integrated database retrieval system