KEGG   Mus caroli (Ryukyu mouse): 110295387
Entry
110295387         CDS       T05910                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04066  HIF-1 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04640  Hematopoietic cell lineage
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110295387 (Epo)
   04066 HIF-1 signaling pathway
    110295387 (Epo)
   04151 PI3K-Akt signaling pathway
    110295387 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110295387 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110295387 (Epo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295387 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110295387 (Epo)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  CSF and other factors
   110295387 (Epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 110295387
NCBI-ProteinID: XP_021019558
Ensembl: MGP_CAROLIEiJ_G0027875
LinkDB
Position
5
AA seq 192 aa
MGVPERPTRLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPR
LSENITVPDTKVNFYAWKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQSSETLQLH
IDKAISGLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYTNFLRGKLK
LYTGEVCRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcccgaacgtcccacccggctgcttttactttccttgctactgattcctctg
ggcctcccagtcctctgtgctcccccacgcctcatctgcgacagtcgagttctggagagg
tacatcttagaggccaaggaggcagaaaatgtcacgatgggttgtgcagaaggtcccaga
ctgagtgaaaatattacagtcccagataccaaagtcaacttctatgcttggaaaagaatg
gaggtggaagaacaggccatagaagtttggcaaggcctgtccctgctctcagaagccatc
ctgcaggcccaggccctgctagccaattcctcccagtcatcagagacccttcagcttcat
atagacaaagccatcagtggtctacgtagcctcacttcactgcttcgagtgctgggagct
cagaaggaattgatgtcgcctccagataccaccccacctgctccactccgaacactcaca
gtggatactttctgcaagctcttccgggtctacaccaacttcctccgggggaaactgaag
ctgtacacgggagaggtctgcaggagaggggacaggtga

DBGET integrated database retrieval system