KEGG   Mus caroli (Ryukyu mouse): 110295417
Entry
110295417         CDS       T05910                                 

Gene name
Areg
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295417 (Areg)
   04012 ErbB signaling pathway
    110295417 (Areg)
   04390 Hippo signaling pathway
    110295417 (Areg)
   04151 PI3K-Akt signaling pathway
    110295417 (Areg)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    110295417 (Areg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcal03110]
    110295417 (Areg)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110295417 (Areg)
Chaperones and folding catalysts [BR:mcal03110]
 Intramolecular chaperones
  Others
   110295417 (Areg)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110295417 (Areg)
SSDB
Motif
Pfam: Rieske FtsL Pestivirus_E2 DUF2207 EGF
Other DBs
NCBI-GeneID: 110295417
NCBI-ProteinID: XP_021019588
Ensembl: MGP_CAROLIEiJ_G0027402
UniProt: A0A6P5PSL6
LinkDB
Position
5
AA seq 248 aa
MRTPLLPLALSVLSLLVLGSDHYAAALELNDPSSRKGESLFGDHSAGGLELSVGREVSTI
SEMPSGSELSTGDYDYSEEYDNEPQISGYIIDDSVRVEQVIKPKKNKTEGEKSTEKPKRK
KKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMK
THSEDDKDLSKIAVVAVTIFVSAVILAAIGIGIVITVHLWKRYLREYEGETEERRRLRQE
NGTVHVIA
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagaactccgctgctaccgctggcgctctcagtgctgtcgctgctggtcttaggctca
gaccattatgcagctgccttggagctcaatgaccccagctccaggaaaggcgaatcgctt
tttggggaccacagtgccggtggacttgagctttctgtgggaagagaggtctccaccata
agcgaaatgccttctggcagtgaactctccacaggggactacgactactcagaggagtat
gataatgaaccacaaatatccggctatattatagatgattcagtcagagttgaacaggtg
attaagcccaagaaaaacaagacagaaggagaaaagtctacagaaaaacccaaaaggaag
aaaaagggaggcaaaaatggaaaaggcagaaggaataagaagaaaaagaatccatgcact
gccaagtttcagaacttttgcattcatggcgaatgcagatacatcgagaacctggaggtg
gtgacgtgcaattgtcatcaagattactttggtgaacggtgtggagaaaaatccatgaag
actcacagcgaggatgacaaggacctatccaagattgcagtagtagctgtcactatcttt
gtctctgccgtcatcctcgcagctattggcatcggcatcgttatcacagtgcacctttgg
aaacgatacctcagggaatatgaaggagaaacggaagaaagaaggaggcttcgacaagaa
aatgggactgtgcacgtcattgcctag

DBGET integrated database retrieval system