KEGG   Mus caroli (Ryukyu mouse): 110295684
Entry
110295684         CDS       T05910                                 

Gene name
Tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04915  Estrogen signaling pathway
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295684 (Tgfa)
   04012 ErbB signaling pathway
    110295684 (Tgfa)
   04014 Ras signaling pathway
    110295684 (Tgfa)
   04151 PI3K-Akt signaling pathway
    110295684 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110295684 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295684 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110295684 (Tgfa)
   05212 Pancreatic cancer
    110295684 (Tgfa)
   05225 Hepatocellular carcinoma
    110295684 (Tgfa)
   05214 Glioma
    110295684 (Tgfa)
   05211 Renal cell carcinoma
    110295684 (Tgfa)
   05215 Prostate cancer
    110295684 (Tgfa)
   05223 Non-small cell lung cancer
    110295684 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110295684 (Tgfa)
SSDB
Motif
Pfam: TMEM154
Other DBs
NCBI-GeneID: 110295684
NCBI-ProteinID: XP_021019759
LinkDB
Position
6
AA seq 98 aa
MLSGLENLVSCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIH
CCQLRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 297 nt   +upstreamnt  +downstreamnt
atgttgtctggcctggagaacctggtaagctgccactctgggtacgtgggtgttcgctgt
gagcatgcagacctcctggctgtggtggctgccagccagaagaagcaagccatcactgcc
ctggtggtggtctccattgtggccctggctgtcctcattatcacctgtgtgctgatccac
tgctgtcagctccgcaaacactgtgagtggtgccgtgccctcgtctgcagacatgagaag
cccagcgccctcctgaagggaaggactgcttgctgccactctgagacagtggtctga

DBGET integrated database retrieval system