KEGG   Mus caroli (Ryukyu mouse): 110295784Help
Entry
110295784         CDS       T05910                                 

Definition
(RefSeq) C-type lectin domain family 6 member A-like
  KO
K17514  C-type lectin domain family 6 member A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110295784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mcal04054]
    110295784
   04091 Lectins [BR:mcal04091]
    110295784
Pattern recognition receptors [BR:mcal04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   110295784
Lectins [BR:mcal04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    110295784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C
Motif
Other DBs
NCBI-GeneID: 110295784
NCBI-ProteinID: XP_021019831
LinkDB All DBs
Position
6
AA seq 168 aa AA seqDB search
MGQKLVTGEQTQSSALLPFSGSVIKLLVHVTEKMWGCCPNHWKSFGSSCYLISTKENFWS
TSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWVDDTPFSQNV
RFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaaattggttactggtgagcaaactcaatcttcagcccttctccctttcagc
gggagtgtgatcaaacttcttgttcatgttacagaaaaaatgtggggatgctgcccaaat
cactggaagtcatttggctccagctgctacctcatttctaccaaggagaacttctggagc
accagtgagcagaactgtgttcagatgggggctcatctggtggtgatcaatactgaagcg
gagcagaatttcatcacccaacagctgaatgagtcactttcttacttcctgggtctttct
gatccacaaggtaatggcaaatggcaatgggtcgatgatactcctttcagtcaaaatgtc
aggttctggcacccccatgaacccaatcttccggaagagcggtgtgtttcaatagtttac
tggaatccttcgaaatggggctggaatgatgttttctgtgatagtaaacacaattcaata
tgtgaaatgaagaagatttacctatga

DBGET integrated database retrieval system