KEGG   Mus caroli (Ryukyu mouse): 110295796
Entry
110295796         CDS       T05910                                 

Gene name
Chd4
Definition
(RefSeq) chromodomain-helicase-DNA-binding protein 4
  KO
K11643  chromodomain-helicase-DNA-binding protein 4 [EC:3.6.4.12]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05165  Human papillomavirus infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110295796 (Chd4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110295796 (Chd4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110295796 (Chd4)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     110295796 (Chd4)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110295796 (Chd4)
  Chromatin remodeling factors
   NuRD complex
    110295796 (Chd4)
SSDB
Motif
Pfam: CHDCT2 DUF1086 SNF2_N CHDNT DUF1087 PHD Helicase_C HDA2-3 PHD_2 HMG_box ResIII zf-HC5HC2H_2
Other DBs
NCBI-GeneID: 110295796
NCBI-ProteinID: XP_021019840
Ensembl: MGP_CAROLIEiJ_G0028869
UniProt: A0A6P5PU75
LinkDB
Position
6
AA seq 1567 aa
MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPDEDLSEAETPKLKKKKKPKKP
RDPKIPKSKRQKKELGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKK
SKSKRKEEEEEEDEDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRP
LIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESMVTATEVA
PPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGGFGSKRKR
SSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTAKKKKKGEEEVTAVDGYET
DHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKEDN
SEGEEILEEVGGDPEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGE
WLCPRCTKEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNG
YSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLG
PHMLRRLKADVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNV
VMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLI
FSQMTKMLDLLEDFLEHEGYKYERXDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGL
GINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKK
MMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDD
KAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDP
DYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASE
EGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRY
GMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQH
VLTRIGVMSLIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQP
NTPAPVPPAEDGIKIEENSLKEEESTEGEKEVKSTAPEATVECAQPPAPAPAPATAPEDD
KAPAEPPEGEEKVEKAEVKERTEEPMETEPKGTTEVEKVEEKSAVDLTPIVVEDKEEKKE
EEEKKEVMLQNGETPKDLSDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKT
XEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARR
FKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKP
ANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPPP
QQVAQQQ
NT seq 4704 nt   +upstreamnt  +downstreamnt
atggcgtcgggcctgggctccccgtccccctgctcagcgggcagtgaggaggaggatatg
gacgcacttctgaacaacagcctgcccccaccccatccagaaaatgaggaagacccagac
gaggatctatccgaagcagagactccaaagctcaagaagaagaaaaagcctaagaaacct
cgagaccctaaaatccctaagagcaagcgccaaaaaaaggagctgggggacagctctggg
gaggggccagagtttgttgaggaggaggaagaggtggctctgcgctcagacagtgagggc
agcgactatactcctggcaagaagaagaaaaagaagctcggacctaagaaggagaagaag
agcaaatccaagcggaaggaggaggaggaagaggaggacgaggatgatgactcgaaggaa
cctaaatcatcagcccagcttttagaagactggggtatggaagacatcgaccatgtgttc
tcagaggaggattaccggaccctcaccaactacaaggccttcagccagtttgtcagaccg
ctgattgctgctaaaaaccccaagattgctgtctccaagatgatgatggtcttgggtgca
aagtggagggaattcagtaccaacaaccccttcaagggcagctcgggagcatcagtggca
gctgcagcggcagcggctgtggctgtggtggagagcatggtgacagctactgaagtcgcc
cctccccctcctcctgtggaggtgccgatccgcaaggccaagaccaaggagggcaaaggt
cccaatgctcggaggaagccgaaaggcagcccgcgagtgcctgacgccaagaagcccaaa
cccaagaaagtagctcctctgaagatcaagctgggagggttcggctccaagcggaagaga
tcctcgagtgaggatgacgatttagatgtagagtctgacttcgacgatgccagtatcaac
agctactctgtttcggacggttccaccagccgcagcagtcggagccgcaagaagctccgg
accgctaaaaagaaaaagaaaggcgaggaggaggtgactgctgtggatggttatgagaca
gaccaccaggactattgcgaggtgtgccagcaaggcggcgagatcatcctgtgtgacacc
tgtccccgagcctaccatatggtgtgcctggacccagacatggagaaggcccccgagggc
aagtggagctgcccgcactgtgagaaggagggaatccagtgggaagctaaggaggacaat
tctgagggtgaggagattctggaagaagtcgggggggacccagaagaggaggatgaccat
catatggaattctgtcgcgtctgcaaggacggcggggagctcctgtgctgtgacacctgc
ccttcttcctaccacatccactgcctgaaccccccgcttccagagatcccaaatggcgaa
tggctctgtccccgctgtactaaagaagcatcggtgaaattccatgtcctgctgacgtcc
tatgagttgatcaccattgatatggccatcttgggttctattgactgggcctgcctcatt
gtggatgaagcccatcggctgaagaacaaccagtctaagttcttccgagttttgaatggt
tactcgctgcagcacaagctgttgctaactggaactccgctacagaacaatctagaggaa
ctgtttcacctgctcaacttcctcacccctgagaggttccacaacttagaaggcttcttg
gaggagtttgcagacattgccaaagaggaccagattaaaaaactccacgacatgctgggg
cctcatatgttgcggcggctcaaagctgacgtcttcaagaatatgccatccaagacagag
ctgattgtgcgcgtggagttgagccctatgcagaagaagtactacaagtatattctcacg
cggaatttcgaagcactgaatgctcgaggtggtggcaaccaggtctctctgctgaatgtg
gtgatggatcttaagaagtgctgcaaccatccttacctcttccctgtggcagcaatggaa
gctcctaagatgcctaatggtatgtatgacggcagtgccctaatcagagcatctgggaag
ttgttgctgctgcagaagatgcttaagaacctgaaagagggagggcatcgtgtgctcatc
ttctcccagatgaccaagatgttggacttgctagaggattttttagaacatgaaggttat
aaatatgaacgtatngatggtggaatcactgggaacatgcgtcaggaggccattgatcgc
ttcaatgcaccgggtgctcaacagttctgcttcttgctttccactcgagctgggggcctt
gggatcaatctggccactgctgacacagttattatatatgactctgactggaacccccat
aatgacatccaggcctttagcagagcccaccgtattggncaaaataagaaggtgatgatc
taccggtttgtgacccgagcatcagtggaggagcgcatcacncaggtggcaaagaagaag
atgatgttgacacatttagtggtacggcctggtctgggctccaaaacaggctcaatgtcc
aaacaggagcttgatgatatcctcaaatttggcactgaggagctattcaaggatgaagcc
acggatggaggaggagacaacaaggagggagaagacagcagtgttatccattatgacgat
aaggccattgagcgactgctggatcgaaaccaggacgagactgaagacacagaattgcag
ggcatgaatgaatatttgagctcatttaaagtggctcagtatgtggtacgggaagaagag
atgggggaggaagaggaggtagaacgggaaatcataaaacaggaagaaagtgtggatcct
gactactgggagaaattgctgcggcaccattatgagcagcagcaagaagatctagcccga
aatctgggcaaaggaaaaagaatccgtaaacaggtcaactacaatgatggctcacaggag
gaccgagattggcaggacgaccagtccgacaaccagtccgattactcagtggcctcagag
gaaggtgatgaagactttgacgaacggtcagaagctccccgcaggcccagtcgcaagggc
ctgcggaatgataaagataagccattacctcctctgttggcccgtgttggtgggaatatt
gaagtacttggttttaatgctcgtcagcggaaagcatttcttaatgcaattatgcgatat
ggcatgccacctcaggatgcttttaccactcagtggcttgtgagagatcttcgaggcaag
tcagagaaagaatttaaggcttatgtgtcactcttcatgcgacatttgtgtgagcctggg
gcagatggggctgagacctttgctgatggtgtcccacgagaaggcctgtctcgtcaacat
gttctcactaggatcggtgtcatgtctctgattcgaaagaaggttcaggagtttgaacat
gtcaatggacgctggagcatgcccgaactggctgaagtagaggaaaacaaaaaaatgtct
cagccaggttcaccctctccaaagactcctacaccttccacaccaggggacacacaaccc
aatactcctgcgcctgtgccacctgctgaggatgggataaaaatagaggaaaatagcctt
aaagaagaagagagcacagaaggagagaaggaagttaaatctacagcccctgaggcgact
gtggagtgtgcacagccccctgcccctgcccctgcccctgccactgcccccgaggatgac
aaggctcctgccgagcctcctgagggggaggaaaaagtggaaaaggcagaggtgaaggag
agaacagaggagcctatggagacagagcccaaaggtactactgaggtggagaaagtggag
gagaagtctgcggtagacctgaccccgatcgtggtggaagacaaagaagagaagaaggag
gaggaagagaaaaaggaggtgatgcttcagaatggggaaacgcccaaggatcttagtgat
gagaagcagaagaaaaacatcaaacagcgtttcatgttcaacattgcagatggtggtttt
actgagttgcactcgctgtggcagaatgaagagcgggcagccacggtcaccaagaagact
tangagatctggcaccgtcgccatgattactggctgctggctggcattataaaccacggc
tatgcccggtggcaggacatccagaatgacccacggtatgccatcctcaatgagcctttc
aagggtgaaatgaatcgtggcaattttctagagatcaagaataaatttttagctcgaaga
ttcaagctcttagaacaagccctggtgatcgaggagcagcttcgcagggcagcttacctg
aacatgtccgaggacccctctcacccgtctatggcccttaacacccgctttgctgaggtg
gagtgtttggcagaaagtcaccagcacctgtccaaggagtcgatggcagggaataagccg
gccaatgcagtcctacacaaagtcctgaaacagctggaagaactgttgagtgacatgaaa
gctgatgtgacgcggctcccagccaccattgcccgcatccccccagtcgctgtgaggtta
cagatgtcagagcggaacattctcagccgcctggcaaacagggcgccagaacctccccca
cagcaggtagcccagcagcagtga

DBGET integrated database retrieval system