KEGG   Mus caroli (Ryukyu mouse): 110295833
Entry
110295833         CDS       T05910                                 

Gene name
Itpr2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04114  Oocyte meiosis
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110295833 (Itpr2)
   04020 Calcium signaling pathway
    110295833 (Itpr2)
   04070 Phosphatidylinositol signaling system
    110295833 (Itpr2)
   04022 cGMP-PKG signaling pathway
    110295833 (Itpr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110295833 (Itpr2)
   04210 Apoptosis
    110295833 (Itpr2)
   04218 Cellular senescence
    110295833 (Itpr2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110295833 (Itpr2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110295833 (Itpr2)
   04621 NOD-like receptor signaling pathway
    110295833 (Itpr2)
   04625 C-type lectin receptor signaling pathway
    110295833 (Itpr2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110295833 (Itpr2)
   04929 GnRH secretion
    110295833 (Itpr2)
   04912 GnRH signaling pathway
    110295833 (Itpr2)
   04915 Estrogen signaling pathway
    110295833 (Itpr2)
   04921 Oxytocin signaling pathway
    110295833 (Itpr2)
   04935 Growth hormone synthesis, secretion and action
    110295833 (Itpr2)
   04918 Thyroid hormone synthesis
    110295833 (Itpr2)
   04928 Parathyroid hormone synthesis, secretion and action
    110295833 (Itpr2)
   04924 Renin secretion
    110295833 (Itpr2)
   04925 Aldosterone synthesis and secretion
    110295833 (Itpr2)
   04927 Cortisol synthesis and secretion
    110295833 (Itpr2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110295833 (Itpr2)
  09154 Digestive system
   04970 Salivary secretion
    110295833 (Itpr2)
   04971 Gastric acid secretion
    110295833 (Itpr2)
   04972 Pancreatic secretion
    110295833 (Itpr2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110295833 (Itpr2)
   04725 Cholinergic synapse
    110295833 (Itpr2)
   04728 Dopaminergic synapse
    110295833 (Itpr2)
   04726 Serotonergic synapse
    110295833 (Itpr2)
   04720 Long-term potentiation
    110295833 (Itpr2)
   04730 Long-term depression
    110295833 (Itpr2)
   04723 Retrograde endocannabinoid signaling
    110295833 (Itpr2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110295833 (Itpr2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110295833 (Itpr2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110295833 (Itpr2)
   05012 Parkinson disease
    110295833 (Itpr2)
   05017 Spinocerebellar ataxia
    110295833 (Itpr2)
   05020 Prion disease
    110295833 (Itpr2)
   05022 Pathways of neurodegeneration - multiple diseases
    110295833 (Itpr2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110295833 (Itpr2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110295833 (Itpr2)
   05163 Human cytomegalovirus infection
    110295833 (Itpr2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110295833 (Itpr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110295833 (Itpr2)
Ion channels [BR:mcal04040]
 Ligand-gated channels
  IP3 receptor
   110295833 (Itpr2)
SSDB
Motif
Pfam: Ins145_P3_rec MIR RYDR_ITPR RIH_assoc Ion_trans DUF2207 MREG
Other DBs
NCBI-GeneID: 110295833
NCBI-ProteinID: XP_021019864
Ensembl: MGP_CAROLIEiJ_G0029053
LinkDB
Position
6
AA seq 2691 aa
MSDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENRKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNVELLDNPGCKEVNAVNCNTSWKITLFMKFSSYREDVLKGGDVV
RLFHAEQEKFLTCDDYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVKDGEIPTPKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTTIPIDTEEERPVMLKIGTC
QTKEDKEAFAIVCVPLSEVRDLDFANDANKVLATTVKKLENGSITQNERRFVTKLLEDLI
FFVADVTNNGQDVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYVLRLCYRVLRHSQQDYRKNQVMLGISPSAPMVAGLTSFLSLPPGQFFSL
SDLQLALVSNLGPTSLVHMFLDYLSDLCVSNSTAIPVTQELICKFMLSPGNADILIQTKL
VSMQVENPMESSILADDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAREGTKADLEVLTYY
RYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCRLMLHMHVDRD
PQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEEYLKEVVNQPF
PFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMSSYFERLSKF
QDGSNNVMRTIHGVGEMMTQMVLSRGSIFPVSVPDAQPIVHPSKQASPGEQEDVTVMDTK
LKVIEILQFILSVRLDYRISYMLSIYKKEFGDNNDNGDPSASGTPDTLLPSALVPDIDEI
AAQAETMFAGRKEKTPVQLDDEGGRTFLRVLIHLIMHDYAPLLSGALQLLFKHFSQRAEV
LQAFRQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSGSYENGDVGEGQAKGGE
EANEESNLLSPVQDGAKTPQIDSNKGNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNM
GAHSVVLDLLEIPYEKTDEKMNEVMDLAHTFLQNFCRGNPQNQVLLHKHLNLFLTPGLLE
AETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKYVKKCQDM
VMTELINGGEDVLIFYNDRASFPILLNMMCSERARGDESGPLAYHITLVELLAACTEGKN
VYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIYTSNHIWKL
FENFLVDMARVCNTTTDRKHADTFLERCVTESVMNIVSGFFNSPFSDNSTSLQTHQPVFI
QLLQSAFRIYNCTWPNPAQKASVESCIRALAEVAKNRGIAIPVDLDSQVNTLFMKNHSST
VQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEQQFSPMMQAEFSVLVD
VLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREMLEKKDSFME
EGSTLRRILLNRYFKGDHSVSVNGPLSGAYAKTAQVGGGFSGQDSDKTGISMSDIQCLLD
KEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQKKSEKFFKVL
YDRMKAAQKEIRSTVTVNTIDLGSKKREEDSDVMALGPRMRVRDSSLHLREGMKGQLTEA
SSATSKAYCVYRREMDPEIDTMCPGQEAGSAEEKSAEEVTMSPAITIMRPILRFLQLLCE
NHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALVNQTLE
SLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLKNNASKLLLA
IMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDEEGGDDGVSPKDVGHNIYI
LAHQLARHNKLLQQMLKPGSDPEEGDEALKYYANHTAQIEIVRHDRTMEQIVFPVPNICE
FLTRESKYRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWG
SISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSALLWVAVAICTSMLFFFSKPVGIRPF
LVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAVILDMAFLYHV
AYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFS
IIGFLFLKDDFTMEVDRLKNRTPVTGNHGVPTMTLSSMMETCQKENCSPTIPSSNTAGEE
GEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVYDLLFFFIVII
IVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMW
HYLYFIVLVKVKDPTEYTGPESYVAQMITEKNLDWFPRMRAMSLVSNEGDSEQNEIRNLQ
EKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPPH
NT seq 8076 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtccagcttcctctacattggggacatcgtgtccctgtacgcggag
ggctcggtcaatggcttcatcagcaccctggggttggtggatgaccgttgtgtggtgcac
ccagaggcgggggaccttgccaacccacccaagaagttcagagactgcctgttcaaggtg
tgccctatgaatcgatactctgcccagaagcaatactggaaagccaagcaggcaaaacag
gggaaccataccgaggctgccctgctgaagaagctccagcatgctgcagagctggaacag
aaacagaatgagtctgagaacaggaaacttttgggagaaatcgtgaaatacagcaacgtt
atccaactgctgcacataaaaagcaacaagtacctgacggtgaacaagaggttacctgcc
ttgctggagaagaatgccatgcgtgtgtcactggatgctgcagggaacgaaggctcctgg
ttctacatccatcccttctggaagctgagaagcgagggtgataatatcgttgtaggagat
aaagtcgttctgatgcctgtaaatgctgggcagcccctgcatgccagcaacgtggagctc
ttggacaatccaggctgcaaagaggtgaatgctgttaattgtaacactagctggaaaatc
actttattcatgaaattcagttcctatcgagaggatgtattaaaggggggtgatgttgtg
agactgtttcatgcggaacaagagaaatttctgacctgtgatgactatgagaaaaaacag
cacattttccttcggacgaccttgcgtcaatcagcaacttcggccactagttctaaagca
ctctgggaaatagaggtggttcaccatgatccatgccgcggaggtgcaggacagtggaac
agcctgttcaggtttaagcatcttgcaactgggaactacttagctgcagagcttaatcct
gactatcgagatgctcaaaatgaaggaaaaaatgtgaaagacggggagattccaacacca
aagaaaaaacgccaggcaggggagaagatcatgtacaccctggtttcagtcccacatgga
aatgacatcgcgtccctttttgaacttgacgccacaactctgcagagagctgactgcctg
gttccgaggaactcctacgtgcggttaaggcacttgtgcaccaacacctgggtaacaagc
accaccatccccatagacacagaggaagagaggcctgtcatgttgaaaattggaacctgc
cagaccaaggaagacaaagaagcctttgccattgtgtgcgtcccgctgtctgaggtccgt
gacttggactttgccaacgatgccaacaaagtgctggccaccacggtgaagaagctggag
aacggcagcatcacacagaatgagaggaggtttgtgactaagttgttggaagacctcatt
ttctttgtggctgacgtgaccaacaacgggcaggacgttctggatgtggttatcaccaag
ccaaaccgggaacggcagaaactaatgagggaacagaatatactggcacaggtgtttggg
atccttaaagcgcctttcaaggagaaggctggagaaggttcgatgctaaggctggaggac
ctgggcgaccagcgctacgccccgtacaagtatgtgctgcgtctctgctaccgtgtgctg
cggcattcgcagcaggactacaggaagaaccaggtgatgctcggcatctctcccagtgct
cccatggttgctggtctcacatcctttctgtccttgcccccaggtcagttttttagcctc
tctgatctgcagttggctcttgtctctaacctcggtcccacttcactcgtccacatgttt
ctggactatttgtctgacctctgtgtgtccaatagcacggccatccccgtcactcaggaa
ctcatttgcaaattcatgctgagccctggcaatgcggacatcctcattcagacaaagctg
gtgtccatgcaagtggagaaccccatggagagctccatccttgctgatgacattgacgac
gaggaggtctggctttactggattgacagcaataaggagcctcacggcaaggccatcagg
cacctcgcccaggaagccagggaaggcaccaaagctgacctggaagttctgacctattat
aggtaccagctaaacctctttgcaaggatgtgcttggaccgccagtacctggccatcaac
cagatttcaacacagctgtccgtagacctgatcctgcggtgtgtgtctgacgagagtctg
ccctttgacctcagagcatctttctgccgactcatgctccacatgcacgttgaccgcgac
ccccaggagtctgtggtgcctgttcgctatgcccgcctctggactgaaatccccacaaag
atcacgattcatgagtatgattccattacagactcttccagaaatgacatgaagaggaag
tttgccctgacgatggaatttgtcgaagaatatttgaaagaagttgtaaatcaaccattt
ccttttggagacaaagagaaaaataaacttacatttgaggtggttcacctagcccggaac
ctcatctactttggattctacagcttcagcgagttactgcggctgacgagaactctgctg
gcgatcctagatattgtccaggcccccatgtcctcatattttgaaagattaagcaagttc
caagatggaagcaacaatgtcatgaggaccatccacggagtgggagagatgatgacacag
atggtgctcagcagaggctccatcttcccagtgagtgtgcccgacgcacagcccatcgtc
caccccagcaagcaggcgagccccggcgagcaggaggatgtgacggtgatggacaccaag
ctgaaggttatcgagattttacagttcatcctgagcgtcaggctggactaccggatctct
tacatgctgtccatatacaagaaggaatttggagacaacaacgacaatggtgacccctct
gccagcggcaccccggacacactgctaccatcagctcttgtccctgacatcgacgagatt
gcagctcaggcagaaacaatgttcgctggaagaaaagaaaaaactccagttcagcttgat
gatgaaggaggcaggacgttcttacgcgtcctcatccacctgatcatgcacgactatgct
ccgctgctgtccggagccctgcagctgctcttcaagcatttcagccagagagcagaagtg
cttcaggcctttagacaggtgcagttactagtgtcgaaccaagatgttgataactacaag
caaatcaaggcagacctggaccaacttcggctgacggtggagaaatctgagctgtgggta
gaaaagagcggcagctatgagaatggagacgtgggtgagggccaggccaaaggaggcgaa
gaggcaaatgaggaatccaacctcttgagcccggtgcaggatggcgcgaagacacctcag
atcgacagcaacaagggcaacaactaccggatcgtcaaggagatcttgattaggctgagt
aagctctgtgtgcagaacaagaaatgccgtaatcaacaccaacggttgctgaaaaacatg
ggggctcactctgtggtgctggaccttctggagatcccttatgagaagaccgacgagaag
atgaacgaggtgatggacttagcccacaccttcctgcagaacttctgtcgtgggaatccg
cagaaccaagttctccttcacaagcatctcaatctgttcctaactcctggcctcctggag
gcagaaaccatgcggcacatcttcatgaacaattatcacctgtgcaacgagatcagcgag
agggtggtccagcacttcgtgcactgcattgagacacatggccgccacgtggagtacctg
aggttcctgcagacgatcgtgaaagcagatggcaaatacgtgaagaaatgccaggacatg
gtcatgacggagttgatcaacgggggcgaggatgtgctgattttctacaacgacagagct
tcatttcccatcctcctcaacatgatgtgctccgagagagcccgtggggacgagagcggc
cccctcgcctaccacatcactcttgtggagttgctggcagcgtgcaccgaaggcaagaat
gtctacacagaaatcaagtgcaattctctcttgcctctggatgacatagtgagagtggtg
acccacgatgactgcattcctgaggtcaaaatcgcgtacgtgaactttgtcaaccattgt
tacgttgacactgaagtggagatgaaggagatctatacaagtaaccacatttggaagtta
tttgagaatttcttggtggatatggcgagggtctgtaacaccaccacagacaggaaacac
gcagacacctttctggagaggtgtgtgacagagtcagtcatgaacatcgtgagcggcttc
ttcaactctccgttttccgacaacagtaccagcctccagacccaccagccagtctttatc
cagctgctgcagtctgccttcagaatttacaactgtacctggcccaacccagcccagaaa
gcctctgtggaatcctgtatcagagccctggctgaagtggccaaaaaccgtgggattgcg
atcccggtcgatttggacagccaggtcaacacgctcttcatgaagaatcactcaagtacg
gtgcagagggcagccatgggctggagactctcagctcgctctggacctcgcttcaaggaa
gctcttggaggaccagcctgggattacagaaatatcattgaaaagttacaggatgtcgtg
gcctccctggaacagcagttcagccccatgatgcaggccgagttctctgtgctcgtggat
gtgctgtacagcccggagctactgttcccagagggaagcgatgccaggatccgatgcggt
gccttcatgtccaagctgattaatcacacaaagaaactgatggagaaagaagaaaagctg
tgcattaaaatcctccagactttacgggagatgctggagaagaaagacagcttcatggaa
gagggtagcacattacggcgaatcctcctgaatcggtacttcaagggtgatcatagcgtt
agtgtgaatggacctctctcaggagcctatgccaagacagcacaagtgggaggaggcttc
tctggacaggattcagataagacgggcatttcaatgtccgatatccagtgtttgctggac
aaagaaggagcatccgaacttgtcatcgatgtcattgtgaacaccaaaaacgacaggatc
ttttccgagggcattttgcttggcattgccttgctggaaggaggaaacacacagacccag
tattctttctaccagcagttgcacgaacaaaaaaagtcagagaaatttttcaaagtcctt
tatgatcggatgaaggctgctcagaaagagatcagatccacggtgaccgtcaacaccata
gacttagggagcaagaagagagaagaggacagtgacgtcatggccctgggccctcggatg
agagtgagagactcgtcgctgcatttgagagaaggaatgaaagggcagttaacagaagcg
tcttcagccacatccaaagcatactgtgtgtacagaagagagatggacccggaaatagac
acaatgtgcccgggacaggaagcaggaagtgcggaggaaaagtctgcggaggaagttacc
atgagcccggccatcaccatcatgcgtcccatcctcaggttcctgcagttactgtgtgag
aatcacaaccgggaacttcagaacttcttgaggaaccagaacaacaaaactaactacaac
cttgtctgtgaaacacttcagttcttggactgcatctgtgggagtaccacagggggtcta
ggcctgctggggctctacatcaatgagaagaacgtagctctggtcaaccagactctggag
agcttgaccgagtactgccaaggcccgtgccacgagaaccagacctgtatcgccactcac
gaatccaatgggattgatatcatcatcgccttgattctgaatgacatcaaccccctgggc
aagtacagaatggacttggtgctgcaactgaagaataacgcctccaagcttctgctggcc
attatggagagcagacatgacagtgagaatgcagagagaatccttttcaacatgagaccc
agggaactggtggatgtcatgaagaatgcctataaccaaggcctggaatgtgaccatggg
gacgaggagggaggtgatgatggtgtttctccaaaagacgttggacacaacatctacatt
ctggcccatcagttggcccgccacaacaaactgctgcagcagatgctcaagccgggatct
gacccagaggaaggggatgaggctttgaagtattacgccaaccacaccgcgcagatcgag
attgtgcggcatgaccggactatggagcaaattgttttcccggtccccaatatctgtgaa
ttcctcactcgggaatccaagtaccgagtgttcaacacaacggagagggatgagcaagga
agcaaggtgaacgacttcttccagcaaacggaagatctctacaatgagatgaaatggcaa
aagaagatcagaaacaaccccgccctgttctggttctccaggcacatctccctctggggg
agcatctccttcaacctggctgtgttcatcaacctggctgtggctcttttctacccattt
ggggatgacggcgatgaaggcacactctccccgctgttctcagccctcctttgggtagca
gtggcgatctgcacatctatgctgttcttcttctccaagcccgtgggcatccggccattc
ctcgtgtctgtcatgctcagatcaatatacaccatcggtttggggccaacgctaatactt
cttggtgctgccaatctatgtaataaaatcgtgttcctggtgagttttgtgggaaaccga
ggcacattcaccagaggctaccgagcagtcattctggacatggcctttctttatcatgtg
gcctatgtcttggtttgcatgcttggcctctttgtccacgagttcttctacagcttcctg
cttttcgatttggtatatagagaagagaccctgctgaacgtcatcaaaagcgtcacacgg
aacggccgctccatcatcctgaccgcggtcttggctcttatcttggtctacctgttctcc
atcatcggcttccttttcttaaaggacgacttcaccatggaggtggacagactgaaaaac
agaactccagtcacaggtaatcacggggttcccactatgaccttatcttccatgatggaa
acctgccagaaggaaaactgctcacccacgatcccctcttccaacacagccggcgaggaa
ggtgaggatggcatagagaggacatgtgataccctgctcatgtgcattgtcacggtgctg
aaccagggcctcaggaatggcggcggagttggggatgtgctgagacgaccctcgaaagat
gagcccttatttgctgcccgggtagtctacgacctcctgttcttcttcattgtcatcatc
atcgttctcaacctgatctttggagtgatcattgacacgtttgctgacctcagaagtgag
aagcagaagaaagaagaaattctcaagacaacctgcttcatctgtggcctggaaagagac
aagtttgataacaagacagtgtcctttgaggagcacatcaagtcagagcacaacatgtgg
cattacctgtacttcatcgtcctggtgaaggtgaaggacccgacagaatacacagggcct
gagagctacgtggctcagatgatcacggagaagaatttggactggtttcctcggatgcga
gccatgtcacttgtcagcaacgaaggtgacagtgagcaaaatgagatccggaacctgcag
gagaagctggagtctactatgagcctggtgaagcagctgtcagggcagctggcagagctg
aaggagcagatgacagaacaaaggaaaaacaagcaaaggctgggctttcttggatcaaac
acaccccatgtgaaccatcacatgccaccgcactga

KEGG   Mus caroli (Ryukyu mouse): 110296867
Entry
110296867         CDS       T05910                                 

Gene name
Itpr1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04114  Oocyte meiosis
mcal04140  Autophagy - animal
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110296867 (Itpr1)
   04020 Calcium signaling pathway
    110296867 (Itpr1)
   04070 Phosphatidylinositol signaling system
    110296867 (Itpr1)
   04022 cGMP-PKG signaling pathway
    110296867 (Itpr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110296867 (Itpr1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110296867 (Itpr1)
   04210 Apoptosis
    110296867 (Itpr1)
   04218 Cellular senescence
    110296867 (Itpr1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110296867 (Itpr1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110296867 (Itpr1)
   04621 NOD-like receptor signaling pathway
    110296867 (Itpr1)
   04625 C-type lectin receptor signaling pathway
    110296867 (Itpr1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110296867 (Itpr1)
   04929 GnRH secretion
    110296867 (Itpr1)
   04912 GnRH signaling pathway
    110296867 (Itpr1)
   04915 Estrogen signaling pathway
    110296867 (Itpr1)
   04921 Oxytocin signaling pathway
    110296867 (Itpr1)
   04935 Growth hormone synthesis, secretion and action
    110296867 (Itpr1)
   04918 Thyroid hormone synthesis
    110296867 (Itpr1)
   04928 Parathyroid hormone synthesis, secretion and action
    110296867 (Itpr1)
   04924 Renin secretion
    110296867 (Itpr1)
   04925 Aldosterone synthesis and secretion
    110296867 (Itpr1)
   04927 Cortisol synthesis and secretion
    110296867 (Itpr1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110296867 (Itpr1)
  09154 Digestive system
   04970 Salivary secretion
    110296867 (Itpr1)
   04971 Gastric acid secretion
    110296867 (Itpr1)
   04972 Pancreatic secretion
    110296867 (Itpr1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110296867 (Itpr1)
   04725 Cholinergic synapse
    110296867 (Itpr1)
   04728 Dopaminergic synapse
    110296867 (Itpr1)
   04726 Serotonergic synapse
    110296867 (Itpr1)
   04720 Long-term potentiation
    110296867 (Itpr1)
   04730 Long-term depression
    110296867 (Itpr1)
   04723 Retrograde endocannabinoid signaling
    110296867 (Itpr1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110296867 (Itpr1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110296867 (Itpr1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110296867 (Itpr1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110296867 (Itpr1)
   05012 Parkinson disease
    110296867 (Itpr1)
   05016 Huntington disease
    110296867 (Itpr1)
   05017 Spinocerebellar ataxia
    110296867 (Itpr1)
   05020 Prion disease
    110296867 (Itpr1)
   05022 Pathways of neurodegeneration - multiple diseases
    110296867 (Itpr1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110296867 (Itpr1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110296867 (Itpr1)
   05163 Human cytomegalovirus infection
    110296867 (Itpr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110296867 (Itpr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110296867 (Itpr1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110296867 (Itpr1)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110296867 (Itpr1)
Ion channels [BR:mcal04040]
 Ligand-gated channels
  IP3 receptor
   110296867 (Itpr1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 110296867
NCBI-ProteinID: XP_021021323
Ensembl: MGP_CAROLIEiJ_G0028703
LinkDB
Position
6
AA seq 2726 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASTHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPLKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDILSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMTKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQSSETSSGNSSQEG
PSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EPMDGASGENEHKKTEEGTSKPLKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTALNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKQELEPSPPLRQLEDHKRGEALRQILVNRYYGNIRPSGRRESLTSFGNGP
LSPGGPSKPGGGGGGPGSSSTSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHES
ILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGN
KKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQSGE
GTQATTDKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETL
QFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGID
IITALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEV
IKKAYMQGEVEFEDGENGEDGAASPRNVGHNIYILAHQLARHNKELQTMLKPGGQVDGDE
ALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFF
LRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGT
LEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCN
KIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLLICAMGLFVHEFFYSLLLFDLVYRE
ETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETG
ESLANDFLYSDVCRVETGENCTSPAPKEELLPAEETEQDKEHTCETLLMCIVTVLSHGLR
SGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKE
EILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVA
EMIRERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMT
EQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8181 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtcgagtttcctacatattggagacatttgttctctgtatgcggag
ggatctacgaatggatttatcagcaccttgggcttggttgatgaccgttgtgttgtacag
ccagaagccggggaccttaacaatccacccaagaaattcagagactgcctctttaagcta
tgtcctatgaatcgatactccgcacagaaacagttttggaaagctgctaagcccggggcc
aacagcactacagatgccgtgctgctcaacaaattgcatcatgctgcagacttggaaaag
aagcagaacgagacagaaaacaggaaattgttggggaccgtcatccaatatggcaacgtg
atccagctcctgcatttgaaaagcaataaatacctgactgtaaataagaggcttccagcc
ttgctagagaagaacgccatgagggtgacgttggacgaggctggaaatgaagggtcctgg
ttttacattcaaccgttctacaagcttcgctccattggagacagtgtggtcataggcgac
aaggtagttttgaatcctgtcaatgctggccagcctctacatgccagcactcatcagctg
gtagataacccaggctgcaatgaggtcaactctgtcaactgtaatacaagctggaagata
gtgcttttcatgaaatggagtgataacaaagacgacattctcaaaggaggtgatgtggtg
aggctcttccatgccgaacaagagaagtttctcacctgcgatgagcacaggaagaagcag
catgtcttcctgaggaccaccggcaggcagtcagccacgtcggccaccagttccaaagcc
ctgtgggaagtggaggtagtccagcacgacccgtgtcggggtggagctgggtactggaat
agcctcttccggttcaagcacctggctacagggcattacttggctgcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggaccctgatcaggatgcatct
cggagcaggttgagaaatgcgcaagaaaaaatggtatactctctggtctccgtacctgaa
ggcaacgacatctcctctatctttgagctagaccccacaactctgcgtggaggtgacagc
cttgtcccaaggaactcctatgtccgtctcagacacctgtgtaccaacacctgggtgcac
agcacaaacatccccattgacaaggaagaggaaaaaccagtgatgctgaaaattggtacc
tctcccctgaaggaggacaaggaagcattcgccatagttcctgtttcccctgctgaggtt
cgggacctggactttgccaatgatgccagcaaggtgctgggctccatcgctgggaagctg
gaaaagggcaccatcacccagaatgagagaaggtctgtcacgaagctgttggaagacttg
gtttactttgtcacgggtggaactaactctggccaagacgtgcttgaagtagtcttctct
aagcccaaccgagagcggcagaagctgatgagggaacagaatattctcaagcagatcttc
aagctgttgcaggcccccttcacggactgcggggatggcccaatgcttcggctggaggag
ctgggagatcagcgccatgctcctttcagacatatttgccgactctgctacagggtcctg
cgacactcacagcaagactacaggaagaaccaggagtacatagccaagcagtttggcttc
atgcagaagcagattggctatgacgtgctggcggaagacaccatcactgccctgctccac
aacaacaggaaactcctggagaagcacatcaccgcggcagagattgacacgtttgtcagc
ctggtgcgaaagaacagggagcccaggttcttggattacctctctgacctctgtgtatcc
atgaacaagtcaatccctgtgacgcaggagctcatctgtaaagctgtgctgaatcccacc
aatgctgacatcctgattgagaccaagttggttctttctcgttttgagtttgaaggcgtt
tccactggagagaatgctctggaagccggggaagatgaggaagaggtgtggctgttctgg
agggacagcaacaaagagatccgtagtaagagtgttagggaattggcgcaagatgctaaa
gagggacagaaggaagacagggacatcctcagctactacagatatcagctgaacctcttt
gcaaggatgtgtctggaccgccagtacctggccatcaatgaaatctctgggcagctggat
gttgatctcattctccgctgcatgtctgacgagaacctcccctatgacctcagggcatcc
ttttgccgcctcatgcttcacatgcatgtggaccgagatccccaggagcaggtgacacct
gtgaaatatgcccgactgtggtcagaaattccctctgagatcgccattgatgactatgac
agcagtggaacatccaaagatgaaattaaagagaggtttgcgcagacgatggagtttgtg
gaggagtacctaagagatgtggtgtgtcaaagattccccttctctgataaggagaaaaac
aagctcacgtttgaggttgtgaacttagccaggaatctcatatactttggtttctacaac
ttttctgaccttctccgattaaccaagatcctcttggcaatcttagactgtgtccatgtg
accactatcttccccattagcaagatgacaaaaggagaagagaataaaggcagtaacgtg
atgagatctatccatggcgttggggagctgatgacccaggtggtgctgcggggaggaggc
ttcttgcccatgactcccatggctgcggcccctgaaggaaatgtgaagcaggcagagcca
gagaaagaggacatcatggtcatggacaccaagttgaagatcattgaaatactccagttt
attttgaatgtgagattggattataggatctcctgcctcctgtgtatatttaagcgggag
tttgatgaaagcaattcccagtcatcggaaacatcctccggaaacagcagccaggaaggg
ccaagtaatgtgccaggtgctcttgactttgaacacattgaagaacaagcagaaggcatc
tttggaggaagtgaggagaacacacctctggacctggatgatcatggtggcagaaccttc
ctcagggtcctgctccacttgacaatgcatgactacccacccctggtgtctggggccctg
cagctcctctttcggcacttcagccagaggcaggaggtccttcaggccttcaaacaggtt
caactgctggttactagccaagatgtggacaactataaacagatcaagcaagacttggac
caactaaggtccattgtggagaagtctgagctctgggtgtacaaaggccagggtcccgat
gagcctatggacggagcctctggtgaaaatgagcataagaaaactgaggaggggacgagc
aagccactgaagcacgaaagcaccagcagctacaactaccgagtggtgaaagagattttg
attcgacttagcaagctctgcgtgcaggagagcgcgtcggtgaggaagagccggaagcag
cagcagcgactgctgaggaacatgggcgcacacgctgtggtgctggagctgctgcagatc
ccctacgagaaggccgaagacaccaagatgcaggagatcatgcggctggctcatgaattt
ttgcagaatttctgtgcaggcaaccagcagaatcaagctttgctgcataaacacataaac
ctgtttctcaacccagggatcctggaggcagtgacgatgcagcacatcttcatgaacaac
ttccagctgtgcagtgagatcaacgagagagtggtccagcactttgttcactgcatagag
acccacggtcgaaacgtccagtatatcaagtttctccagacgattgtcaaggcagaaggg
aaattcattaaaaagtgccaagacatggtcatggctgagcttgtcaactctggagaggac
gtcctcgtgttctacaatgacagagcctctttccagactctgatccagatgatgcggtcc
gagcgtgaccggatggatgagaacagccctctcatgtaccacatccatctggtggagctc
ttggctgtgtgcacagagggcaagaatgtgtacacagagatcaagtgcaactccttgctc
ccgctcgatgacatcgttcgtgtggtcactcatgaagactgcatccccgaggttaagatc
gcttacattaacttcctgaatcactgctatgtggatactgaggtggagatgaaggagatt
tacacgagcaaccacatgtggaagttgtttgagaatttcctcgtggacatctgcagggcc
tgtaacaacacaagcgacaggaagcacgcagactccattctggagaagtacgtcactgaa
atcgtgatgagcatcgtcaccaccttcttcagctctcccttctcagaccagagcaccact
cttcagacccgccagcctgtctttgtgcaactcctgcaaggcgtgttccgagtttaccac
tgcaactggctgatgccaagccaaaaagcctcggtggagagctgcatccgggtgctctct
gacgtagccaagagccgggccatagccattcctgttgacctggacagccaagtcaacaac
ctcttcctgaagtcccacaacattgtgcagaaaacagccctgaactggcggttatcagcc
cgcaacgccgctcgcagagactctgtactggcagcatccagagactaccgaaatatcatt
gagaggttacaggacatcgtgtctgccctagaggaccgactcaggcccctggtccaggct
gagctgtctgtgctcgtggatgttctacacagaccagaactgcttttccccgagaatacg
gatgccaggaggaaatgtgagagtggaggtttcatctgcaagctaataaaacataccaag
cagctgctggaggagaatgaagagaaactgtgcattaaagtcttacagaccctcagggaa
atgatgaccaaagacagaggctatggagagaagcaggagcttgaaccaagtccacccctg
aggcaactggaagaccataaaaggggtgaggcactccggcaaattttggtcaaccgttac
tatggaaacatcagaccttcaggaagaagagagagccttaccagctttggcaatggccca
ctatcaccaggaggacccagcaagcctgggggaggagggggaggtcctggatccagttcc
acaagcaggggtgagatgagcctggctgaggttcagtgtcacctcgacaaggagggggcc
tccaatctggtcatcgatctcataatgaatgcatcaagtgaccgagtatttcatgaaagc
attttgctggccatcgcacttctggaaggaggcaacaccaccatccagcactcatttttc
tgccggctgacagaagataagaaatcagagaagttcttcaaggttttttacgatcgaatg
aaggtggcccagcaagaaatcaaggcaacagtgacagtgaacaccagcgacttgggaaac
aaaaagaaagatgatgaagtggacagggatgccccgtctcggaagaaagccaaagaaccc
acaacacagataacagaagaggtccgggatcagctcctggaagcatctgctgccaccagg
aaagcctttaccaccttccggagggaggccgaccctgatgaccattaccagtctggggag
ggcacccaggccacaaccgacaaagccaaggatgacctagagatgagcgctgtcatcacc
atcatgcagcctatcctgcgcttcctgcagcttctgtgtgaaaaccacaaccgagatctg
cagaatttccttcgttgccaaaataataagaccaactacaatttggtgtgtgagacactg
cagtttctggactgtatctgtgggagcacaaccggaggccttggtcttcttggactgtac
ataaacgaaaagaatgtagcacttatcaaccaaaccctggagagtctgacggagtactgt
caagggccttgccatgagaaccagaactgcatcgccacccacgagtccaatggcatcgat
atcatcacagccctcatcctcaatgatatcaaccctctgggaaagaagcggatggacctg
gtgttagaactgaagaacaatgcttcgaagctactcctggccatcatggaaagcagacac
gacagtgaaaatgcagagaggatcctgtataacatgaggcccaaggagctggtggaagtg
atcaagaaggcctacatgcaaggtgaagtggaatttgaggatggggagaatggtgaggat
ggagctgcctcccccaggaacgtgggccacaacatctacatcctcgctcaccagttggct
cggcataacaaagaacttcaaaccatgctgaaacctggaggccaggtggatggggatgaa
gctctggagttctacgcgaagcacacagcacaaattgagattgtcagactggaccggaca
atggaacagatcgtcttccccgtgcccagcatctgtgaattcctgactaaggaatcgaaa
cttcgaatatattacaccacagagcgggatgagcaaggtagcaagatcaatgacttcttc
ctgcgctccgaggacctctttaacgagatgaactggcagaagaaacttcgagcccaacct
gtcttgtactggtgtgcccgaaacatgtctttctggagcagcatctctttcaacctggcc
gtcctgatgaacctgctggtggcgtttttctatccatttaaaggagtgaggggaggaacg
ctagagccacactggtcaggcctcctgtggacagccatgctcatctctctggccattgtc
attgctctgcccaagccccacggcatccgggccttaattgcttctacaatcctacgactg
atattttcagttgggttgcaacccacactgtttctgctgggagctttcaatgtctgcaat
aaaatcatcttcctgatgagctttgtgggcaactgtgggaccttcaccagaggctaccgg
gccatggttctggatgtggagttcctctatcatttgctgtatctactcatctgtgccatg
ggcctcttcgtacatgaattcttctatagcttgctgctttttgatttagtgtacagagag
gagactttgcttaatgtcattaaaagtgtcacccgcaatggacggtccatcatcttgaca
gcggtcctggctctgatcctggtttacctgttctcgattgtgggctatctgttcttcaag
gatgactttatcttggaagtagataggttgcccaatgaaacagctgtcccagaaactggc
gagagtttggccaacgatttcctgtactctgatgtgtgcagggtagagacgggggagaac
tgcacctctcctgcacccaaagaagagctgctccctgcagaagaaacagaacaggataag
gaacacacgtgtgagaccctgctcatgtgcatcgtcactgttctgagtcacgggctgcgg
agtgggggaggggtaggagacgtgctcaggaagccatccaaagaggagcctctgtttgct
gcaagggtgatctacgacctcctcttcttcttcatggtcatcatcatcgtcctgaacctg
atttttggggtcatcatcgacacctttgctgacctgaggagtgagaagcaaaagaaggag
gagatcttaaaaaccacgtgcttcatctgcggcttggaaagggacaagtttgacaataag
actgtcacctttgaagagcacatcaaggaagaacacaacatgtggcactatctgtgcttc
atcgtgctggtgaaagtgaaggactccacagagtacacggggcctgagagttacgtggca
gagatgatcagggaaagaaaccttgattggttccccagaatgagagccatgtccctggtc
agcagcgattctgaaggggaacagaacgagctgaggaacctgcaggagaagctggagtct
accatgaagctggtcaccaatctttctggccagctgtcagaactaaaggaccagatgaca
gaacagaggaagcagaaacaaagaattggccttctaggacatcctcctcacatgaatgtc
aacccacagcagccggcctag

KEGG   Mus caroli (Ryukyu mouse): 110312193
Entry
110312193         CDS       T05910                                 

Gene name
Itpr3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04114  Oocyte meiosis
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04742  Taste transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110312193 (Itpr3)
   04020 Calcium signaling pathway
    110312193 (Itpr3)
   04070 Phosphatidylinositol signaling system
    110312193 (Itpr3)
   04022 cGMP-PKG signaling pathway
    110312193 (Itpr3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110312193 (Itpr3)
   04210 Apoptosis
    110312193 (Itpr3)
   04218 Cellular senescence
    110312193 (Itpr3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110312193 (Itpr3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110312193 (Itpr3)
   04621 NOD-like receptor signaling pathway
    110312193 (Itpr3)
   04625 C-type lectin receptor signaling pathway
    110312193 (Itpr3)
  09152 Endocrine system
   04911 Insulin secretion
    110312193 (Itpr3)
   04922 Glucagon signaling pathway
    110312193 (Itpr3)
   04929 GnRH secretion
    110312193 (Itpr3)
   04912 GnRH signaling pathway
    110312193 (Itpr3)
   04915 Estrogen signaling pathway
    110312193 (Itpr3)
   04921 Oxytocin signaling pathway
    110312193 (Itpr3)
   04935 Growth hormone synthesis, secretion and action
    110312193 (Itpr3)
   04918 Thyroid hormone synthesis
    110312193 (Itpr3)
   04928 Parathyroid hormone synthesis, secretion and action
    110312193 (Itpr3)
   04924 Renin secretion
    110312193 (Itpr3)
   04925 Aldosterone synthesis and secretion
    110312193 (Itpr3)
   04927 Cortisol synthesis and secretion
    110312193 (Itpr3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110312193 (Itpr3)
  09154 Digestive system
   04970 Salivary secretion
    110312193 (Itpr3)
   04971 Gastric acid secretion
    110312193 (Itpr3)
   04972 Pancreatic secretion
    110312193 (Itpr3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110312193 (Itpr3)
   04725 Cholinergic synapse
    110312193 (Itpr3)
   04728 Dopaminergic synapse
    110312193 (Itpr3)
   04726 Serotonergic synapse
    110312193 (Itpr3)
   04720 Long-term potentiation
    110312193 (Itpr3)
   04730 Long-term depression
    110312193 (Itpr3)
   04723 Retrograde endocannabinoid signaling
    110312193 (Itpr3)
  09157 Sensory system
   04742 Taste transduction
    110312193 (Itpr3)
   04750 Inflammatory mediator regulation of TRP channels
    110312193 (Itpr3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110312193 (Itpr3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110312193 (Itpr3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110312193 (Itpr3)
   05012 Parkinson disease
    110312193 (Itpr3)
   05014 Amyotrophic lateral sclerosis
    110312193 (Itpr3)
   05017 Spinocerebellar ataxia
    110312193 (Itpr3)
   05020 Prion disease
    110312193 (Itpr3)
   05022 Pathways of neurodegeneration - multiple diseases
    110312193 (Itpr3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110312193 (Itpr3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110312193 (Itpr3)
   05163 Human cytomegalovirus infection
    110312193 (Itpr3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312193 (Itpr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110312193 (Itpr3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110312193 (Itpr3)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110312193 (Itpr3)
Ion channels [BR:mcal04040]
 Ligand-gated channels
  IP3 receptor
   110312193 (Itpr3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 110312193
NCBI-ProteinID: XP_021041402
Ensembl: MGP_CAROLIEiJ_G0021295
UniProt: A0A6P5R8Y7
LinkDB
Position
17
AA seq 2670 aa
MNEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDVSDPKAAGPGAQGRTGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNAPIDVEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPLVRLEE
LSDQKNAPYQYMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNRIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISKQLGVELLFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDY
LNNVVSEAVPFANDEKNILTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCIQAPAA
MLQAYEEPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGASSLPAGVGVPEQLDRSKFEDNE
HTVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSST
ATMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLLHLTMHDYPSLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSVKGEEVE
AGATKDKKERPSDEEGFLQPHGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKSDNKMLEILRYTHQFLQKFCAGNPGNQALLHKHLQLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVTVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMALVCNKREKRLSDPTLEKYVLTVVLDTISAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACVRTLAMVAKSRAILLPMDLDAHMSALLSSGGSCSA
AAQRSAANYKTATRTFPRVIPTANQWDYKNIIEKLQDIIMALEERLKPLVQAELSVLVDV
LHWPELLFPEGSEAYQRCESGGFLSKLIRHTKGLMESEEKLCVKVLRTLQQMLLKKSKFG
DRGNQLRKMLLQNYLQNRKSGARGELTDPTGSGLDQDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMSDLGSQPREDREPADPATKGRVSSFSMPSSSRYLLGPGLHRGHDVSERAQNN
EMGTSVLIMRPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGG
LGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPL
CKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEEREN
SEVSPREVGHNIYILALQLSRHNKQLQHLLKPVRRIQEEEAESISSMLSLNNKQLSQMLK
SSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPAICQFLTEETKHRLFTTTEQ
DEQGSKVSDFFDQSSFLHNEMEWQRRLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAF
FYPYVEGASTGVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLGIGPT
LNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFY
SILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDR
LPGNHSRASPLGMPHGAATFMGTCSGDKMDCVSEVSVPEILEEDEEPDSTERACDTLLMC
IVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFA
DLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKT
DYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVSHLTS
QLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8013 nt   +upstreamnt  +downstreamnt
atgaatgaaatgtccagctttcttcacatcggggacattgtgtccctgtacgccgagggc
tccgtcaatggtttcatcagcactttggggctggtggatgaccgttgtgtggtggaacct
gcagccggggacctggacaacccccccaagaagttccgagattgcctcttcaaagtgtgc
cccatgaaccgctactccgcacagaaacagtactggaaagccaagcagactaaacaggac
aaagagaagattgctgatgtggtattgctgcagaagctgcagcatgcagcccagatggag
cagaagcaaaatgacacagagaacaagaaggtgcacggggacgtggtgaagtatggcagc
gtgattcagcttctgcatatgaagagcaacaaatacttaaccgtgaataagcggctgcca
gccctgctggagaagaatgccatgcgggtgactctggatgctacgggcaatgagggctcc
tggctcttcatccagcccttctggaagcttcggagcaatggggataatgtggtcgtgggg
gacaaggtgatcctgaatcctgtcaatgctgggcagcccttacatgccagcaactatgag
cttagtgataatgctggctgcaaagaggtcaactctgtcaactgcaacaccagctggaag
atcaacttattcatgcagttccgggaccacctggaggaggtgctgaaggggggagacgtg
gtgcggctgttccacgcggagcaggagaagttcctgacctgtgatgagtacaggggcaag
ctgcaggtgttcctgcggaccacgctccgccagtctgccacctcggccaccagctccaac
gcactctgggaggtggaggtggtccaccacgacccctgccgcgggggagccggacactgg
aacggtctgtacaggttcaagcacctggccacgggcaactatctggccgctgaggaaaac
cccagctacaagggtgacgtctcagatcctaaggcagccggaccgggggcccagggccgc
actggccgcaggaatgcgggcgagaagatcaagtaccgtctggtggctgtgccacatggg
aatgacatcgcatctctcttcgagctggaccccaccacgctgcagaaaaccgactccttc
gtgccccggaactcctacgtgcggcttcggcacctctgcaccaacacctggatccagagt
accaacgcgcccatcgatgtggaggaggaacggcctatccggctcatgttgggcacatgc
cccaccaaggaggacaaagaggcctttgccattgtgtcggttcccgtgtcggagatccgc
gacctggactttgccaatgacgccagctccatgctggccagcgccgtggagaaactcaac
gaaggcttcatcagccagaacgaccgcaggtttgtcatccagctgttggaggacttggtg
ttttttgtcagcgatgttcccaacaatgggcagaatgtcctggacatcatggtcaccaag
cccaaccgggagcggcagaagctgatgcgggagcagaacatacttaagcagatctttggc
atcctgaaggctccattccgtgacaaggggggtgaaggaccactagtgcggctggaggaa
ctgtctgaccagaagaacgccccctaccagtacatgttccgtctctgctaccgggtgtta
cggcactctcaggaggactaccgcaagaaccaggagcacatagccaagcagttcgggatg
atgcagtcacagattggctatgacatcctggctgaagacaccatcactgccctgctgcac
aacaaccgcaagcttctggagaaacacatcaccaagacggaggtggagaccttcgtcagc
ctcgtgcgcaagaacagggagcccagattcctggactacctctccgacctgtgtgtgtcc
aaccgtattgccatccctgtcacccaagagctgatttgcaaatgtgtgctggaccctaag
aacagtgacattcttatccagactgagctgcggccagtgaaggagatggctcagtctcac
gagtacctcagcattgagtactcagaggaggaggtgtggctcacgtggacggacaggaac
aatgagcaccacgagaagagcgtgaggcagctggcccaggaggcgagggctggcaacgcg
cacgacgagaatgtgctcagctactacaggtaccagttgaagctgtttgcccgcatgtgc
ctggaccgccagtacttggccattgatgagatctccaagcagctgggcgtcgagctgctt
ttcctgtgcatggctgacgagatgctgccctttgacctccgcgcctcattctgccatctg
atgctacatgtgcacgtggaccgtgaccctcaggagctggtgacccctgtcaagtttgcc
cgcctctggacagagatccccacggccatcaccattaaagactatgattccaatctcaac
gcgtcaagagatgacaaaaaaaacaagtttgccagcaccatggagttcgtagaagattac
ctcaacaacgtggtcagcgaggccgtgccctttgccaacgacgagaagaacatactcacc
tttgaggtggtgagcctggcgcacaatctcatctacttcgggttctacagcttcagcgag
ctgctgaggctcacacgcacgctactgggcatcatagactgcatccaggcaccggcagcc
atgctgcaggcctacgaggagcctggtggcaagaatgtgcggaggtccatccagggggtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtctgtatttggtgcctccagc
ctgcctgctggagtgggtgttcctgagcagctagacagaagcaaatttgaggacaatgag
cacaccgtggtgatggagaccaaactgaagatcctggagattctgcagttcatcctgaac
gtacgcctagactaccgcatctcctacctgttgtcggtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagcggggcagacggcacggcacccgcctttgattcctccact
gccaccatgaatctggaccgcatcggagagcaggcagaggccatgtttggagtagggaag
accagcagcatgctggaggtggacgatgaaggcggccgcatgttcctgcgagtgctgctg
cacctgaccatgcatgactacccatctcttgtctccggggcgctgcagctgctcttcaaa
cacttcagccagcgccaggaagccatgcacactttcaagcaggtccagttgctgatctca
gcccaggatgtggagaactacaaggtgatcaagtcagaactggaccgactgcggacaatg
gtggagaagtcggagctgtgggtggacaagaaaggcagcgtcaagggcgaggaggttgag
gcaggcgccaccaaggataagaaggagagaccctcggacgaggaggggtttctgcagcca
cacggggaaaagagcagcgagaactaccagattgtgaaaggcatcctggagaggctgaac
aagatgtgtggggtgggggagcagatgaggaagaagcaacagaggttgctgaagaacatg
gacgcccacaaggtcatgctggacctactgcagatcccttacgacaagagcgacaacaag
atgctggagatactgcgctacacacaccagttcctacagaagttctgtgctgggaaccct
ggcaaccaggcccttctgcacaaacacttgcagctcttcctcacgcctgggctcctggag
gctgagaccatgcagcacattttcctcaacaactaccagctctgctctgagatcagcgag
ccggtgctgcaacactttgtgcacctgctggccacacacgggcgccacgtgcagtacctg
gacttcctgcacaccgtcatcaaggctgagggcaagtacgtgaagaagtgccaggacatg
attatgaccgagctgaccaatgcaggtgacgacgtggtggtgttctacaatgacaaggcc
tctctggctcatctgttggacatgatgaaggcagccagagatggcgtggaggaccacagc
cctctcatgtatcacatctccctggtggacctgctggctgcctgtgcagagggcaagaac
gtctacacagagatcaagtgcacctccctcttgcctctagaggacgtggtgactgtggtc
acccacgaggattgcatcacggaggttaaaatggcttatgtgaatttcgtgaatcactgc
tacgtagacacggaggtggagatgaaggagatctacaccagcaaccacatctggacgctc
ttcgagaacttcaccctggacatggctctggtctgtaacaagcgggagaagcgcctgtca
gaccccacccttgagaagtacgtgctcaccgtggtcctggacaccatcagcgccttcttc
agctctccgttttcagagaacagcacgtccctacagacgcaccagacaattgtggtccag
ctactgcagtccaccacgcggctgctcgagtgtccttggctgcagcagcagcataagggc
tccgtggaggcctgtgtccgcaccctcgccatggtggccaagagtagagccatcttgctg
ccgatggatctggatgcccacatgagcgccctgctcagcagtgggggcagctgttctgcc
gctgcccagcgcagcgctgccaactacaagacggccaccaggaccttccctcgggtcatc
cccactgccaaccagtgggactacaagaacatcattgagaagttacaggacatcatcatg
gccctagaagagcggctgaagcctctggtgcaggctgagctctctgtccttgtggacgtg
ctgcactggcccgagctgctttttccagagggcagtgaggcctaccagcgctgcgagagc
gggggcttcctgtccaagctcatccgtcacaccaagggtctcatggagtcagaggagaag
ttgtgcgtgaaggtgctgcggacgctgcagcagatgctgctgaagaagagcaagtttggg
gaccggggcaaccagctgcggaaaatgctgctgcagaattacctccagaaccgcaagtct
ggcgcccggggcgagctcactgaccccacgggctctggcctggatcaggactggtcagct
atcgctgccacccagtgccggctggacaaggagggggccaccaagctggtgtgtgatctc
atcaccagcaccaagaacgagaagatcttccaggagagcattggcctggccatccgcctg
ctggacgggggcaacaccgagatccagaagtctttctacaacctgatgacgagcgacaag
aagtcggagcgcttcttcaaggtgcttcatgaccgcatgaagcgtgcccagcaggagacc
aagtccacggtcgctgtcaacatgagcgacctgggcagccagcctcgtgaggaccgggag
ccggcagaccctgccaccaaaggacgtgtgtcctccttctccatgcccagctcctcccgc
tatttgctgggccctggcttgcaccgggggcacgatgtgagcgagcgggctcagaacaat
gagatggggacctcagtgttgatcatgcggcccatcctgcgcttcctacagctgctgtgt
gagaaccacaaccgtgacctgcaaaacttcctgcgctgtcagaacaacaagaccaactac
aacctggtgtgtgagaccctgcagttcctggacatcatgtgtggcagcaccacagggggc
ctggggctgctggggctctacattaacgaggacaacgtgggcttggtcatccagaccttg
gagaccctcacagagtactgccagggcccgtgtcacgagaaccagacctgcattgtgact
cacgaatccaacggcattgacatcatcacggcgctgatcctcaatgacatcagcccgctt
tgcaagtaccgcatggacctggtgctgcagctcaaggacaatgcctccaagctgctcctg
gctctgatggagagccgacatgacagtgagaatgcagagcgcatcctcatcagccttcgg
cctcaggagctggtggatgtgatcaagaaggcctacctgcaggaggaggagagggagaat
tcagaggtgagcccacgtgaagtgggccacaacatctacatcctagcattgcagctttcc
aggcacaacaagcagctgcagcacctgctgaagccagtgaggcgcatccaggaggaggag
gctgagagcatctcttccatgctcagcctcaacaataagcagctgtcccagatgctcaag
tcctcggcccccgcccaggaggaggaggaggacccgctggcctactatgagaatcacacc
tcacagattgagattgtgcggcaagaccgaagcatggagcagatcgtgttcccggtacct
gccatctgccagttcctgacagaggagacgaagcaccggctcttcaccaccactgagcag
gacgagcagggcagcaaagtgagcgacttcttcgaccaatcctccttcctgcacaacgag
atggagtggcagcgccggcttcgcagcatgccgctcatctactggttctcccgccgcatg
acgctatggggcagcatctccttcaacctggcagtgttcatcaacatcatcattgccttc
ttctacccctatgtggagggtgcttccacaggcgtgctgggctccccgctcatctcgcta
ctcttctggatcctcatctgcttctccatcgctgcactgttcaccaagcgctacagtgtc
cgtcccctcatcgtggcgctgatccttcggtccatctactacctgggcattgggcccacg
ctcaacatcctgggtgctctcaatctgaccaacaagatcgtgtttgtggtgagcttcgtg
ggcaaccgtggtacctttatccgaggctataaggccatggtcatggacatggagttcctg
taccatgtgggctacatcctgacaagcgtcctgggcctctttgcccatgagctcttctac
agcatcctgctctttgacctcatctaccgagaggagacactgtttaatgtcatcaagagt
gtgacccgcaatggccgctctatcctactgaccgccctgctggccctcatccttgtgtac
ctcttctccatcgtgggcttcctcttcctcaaggacgacttcatcctggaggtggaccgg
ctgcccgggaaccattccagagccagccccctggggatgccacacggagctgccacattt
atgggcacatgtagcggggacaagatggactgtgtctctgaggtctcggtgcctgagatc
ctagaagaggacgaggagcctgatagcacggagcgggcctgtgacactctacttatgtgt
attgtgaccgtcatgaaccacgggctgaggaatggtggtggcgtgggcgacatcctccgc
aagccctccaaagatgagtcactcttccccgccagggtggtgtatgacctcctgttcttc
ttcatcgtcatcatcatcgtgttgaacctcatctttggggtgatcatcgacaccttcgcc
gacctgcgcagcgagaagcagaagaaggaggaaatcctcaagaccacgtgcttcatctgt
ggtctggagagggacaagtttgacaacaagacggtgtccttcgaggagcacatcaaactg
gagcataacatgtggaactacctgtacttcattgtactggtccgagtcaagaacaagacg
gactacaccggcccagagagctacgtggctcagatgatcaagaacaagaacctggactgg
ttcccgcggatgcgcgccatgtccctggtgagcggcgagggggagggggagcagaatgag
atccgcatcctgcaggagaagctcggctccaccatgaagctggtgtcgcacctcacctcc
cagctcaatgagctcaaggagcagatgacggagcagcggaaacggaggcagcgtctgggc
tttgtggatgtgcagaactgcatgagccgctga

DBGET integrated database retrieval system