KEGG   Mus caroli (Ryukyu mouse): 110295945
Entry
110295945         CDS       T05910                                 

Gene name
Braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04015  Rap1 signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04068  FoxO signaling pathway
mcal04150  mTOR signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04510  Focal adhesion
mcal04650  Natural killer cell mediated cytotoxicity
mcal04720  Long-term potentiation
mcal04722  Neurotrophin signaling pathway
mcal04726  Serotonergic synapse
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05034  Alcoholism
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295945 (Braf)
   04012 ErbB signaling pathway
    110295945 (Braf)
   04015 Rap1 signaling pathway
    110295945 (Braf)
   04068 FoxO signaling pathway
    110295945 (Braf)
   04024 cAMP signaling pathway
    110295945 (Braf)
   04150 mTOR signaling pathway
    110295945 (Braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110295945 (Braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110295945 (Braf)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110295945 (Braf)
   04062 Chemokine signaling pathway
    110295945 (Braf)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110295945 (Braf)
   04914 Progesterone-mediated oocyte maturation
    110295945 (Braf)
   04928 Parathyroid hormone synthesis, secretion and action
    110295945 (Braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110295945 (Braf)
  09156 Nervous system
   04726 Serotonergic synapse
    110295945 (Braf)
   04720 Long-term potentiation
    110295945 (Braf)
   04730 Long-term depression
    110295945 (Braf)
   04722 Neurotrophin signaling pathway
    110295945 (Braf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295945 (Braf)
   05205 Proteoglycans in cancer
    110295945 (Braf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110295945 (Braf)
   05212 Pancreatic cancer
    110295945 (Braf)
   05225 Hepatocellular carcinoma
    110295945 (Braf)
   05226 Gastric cancer
    110295945 (Braf)
   05214 Glioma
    110295945 (Braf)
   05216 Thyroid cancer
    110295945 (Braf)
   05221 Acute myeloid leukemia
    110295945 (Braf)
   05220 Chronic myeloid leukemia
    110295945 (Braf)
   05218 Melanoma
    110295945 (Braf)
   05211 Renal cell carcinoma
    110295945 (Braf)
   05219 Bladder cancer
    110295945 (Braf)
   05215 Prostate cancer
    110295945 (Braf)
   05213 Endometrial cancer
    110295945 (Braf)
   05224 Breast cancer
    110295945 (Braf)
   05223 Non-small cell lung cancer
    110295945 (Braf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110295945 (Braf)
   05022 Pathways of neurodegeneration - multiple diseases
    110295945 (Braf)
  09165 Substance dependence
   05034 Alcoholism
    110295945 (Braf)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110295945 (Braf)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110295945 (Braf)
   05160 Hepatitis C
    110295945 (Braf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110295945 (Braf)
   01522 Endocrine resistance
    110295945 (Braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110295945 (Braf)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110295945 (Braf)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110295945 (Braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 APH Kdo
Other DBs
NCBI-GeneID: 110295945
NCBI-ProteinID: XP_021020018
Ensembl: MGP_CAROLIEiJ_G0028251
LinkDB
Position
6
AA seq 764 aa
MAALSGGGGSSSGGGGGGGGGGGGGDGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAI
PEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESL
VFQTPTDVSRNNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCA
VYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLF
QGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPVPQEEASLPETALPSGS
SSAPPSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPV
NIDEKFPEVELQDQRDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRE
RKSSSSSSSEDRSRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVK
MLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHI
IETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSR
WSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRD
QIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
IHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggcggcgctgagtggcggcggtggcagcagcagcggtggcggcggcggcggtggcggc
ggcggtggcggtggcgacggcggcggcggcgccgagcagggccaggctctgttcaatggc
gacatggagccggaggccggcgctggcgccgcggcctcttcggctgcggacccggccatt
cctgaagaggtatggaatatcaagcaaatgattaagttgacacaggaacatatagaggcc
ctattggacaaatttggtggagagcataacccaccatcaatatacctggaggcctatgaa
gagtacaccagcaagctagatgcccttcagcaaagagaacagcagcttttggaatccctg
gtttttcaaactcccacagatgtatcacggaacaaccccaagtcaccacagaaacctatc
gttagagtcttcctgcccaacaaacagagaacagtggtacctgcaagatgtggtgttaca
gttcgagacagtctaaagaaagcactgatgatgagaggtctcatcccagaatgctgtgct
gtttacagaattcaggatggagagaagaaaccaattggctgggacacggacatttcctgg
cttactggagaggagttacatgttgaagtactagagaatgttccacttacaacacacaac
tttgtacggaaaacttttttcaccttagcattttgtgacttttgccgaaagctgcttttc
cagggtttccgttgtcaaacatgtggttataaatttcaccagcgttgtagtacagaggtt
ccactgatgtgtgtaaattatgaccaacttgatttgctgtttgtctccaagttctttgag
catcacccagtaccacaggaggaggcctccttaccagagactgcccttccatctggatcc
tcttccgcacccccctcagactctattgggccccaaatcctcaccagtccatctccttca
aaatccattccaattccacagcccttccgaccagcagatgaagatcatcgcaatcagttt
gggcaacgagaccggtcctcctcagctcctaatgttcatataaacacaattgagcctgtc
aatatcgatgaaaaattcccagaagtggaattacaggatcaaagggatttgattagagac
caggggtttcgtggtgatggagggtcaaccacaggcttgtccgccaccccgcctgcctca
ttacctggctcactcactaacgtgaaagccttacagaaatctccaggtcctcagcgggaa
aggaagtcgtcttcttcctcatcctcggaggacagaagtcggatgaaaacacttggtaga
agagattcaagtgatgactgggagattcctgatggacagattacagtgggacagagaatt
ggatctgggtcatttggaactgtctacaagggaaagtggcatggtgatgtggcagtgaaa
atgttgaatgtgacagcacccacacctcaacagttacaggccttcaaaaatgaagtagga
gtactcaggaaaactcgacatgtgaacatcctccttttcatgggctattctacaaagcca
caactggcaattgttacacagtggtgtgagggctccagcttatatcaccatctccacatc
attgagaccaaatttgagatgatcaaacttatagatattgctcggcagactgcacagggc
atggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatattt
cttcatgaagacctcacggtaaaaataggtgactttggtctagccacagtgaaatctcgg
tggagtgggtcccatcagtttgaacagttgtctggatctattttgtggatggcaccagaa
gtaatcagaatgcaagataagaacccgtatagctttcagtcagatgtgtatgcattcggg
attgtgctgtatgaactgatgactggccagctaccttattcaaacatcaacaacagggac
cagataatttttatggtgggacgaggatacctatccccagatctcagtaaggtacggagt
aactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagacgag
agaccactctttccccaaattctcgcctccattgagctgctggcccgctcattgccaaaa
attcaccgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaagatttt
agtctgtatgcttgtgcttctccgaaaacacccatccaagcagggggatatggagaattt
gcagccttcaagtag

DBGET integrated database retrieval system