KEGG   Mus caroli (Ryukyu mouse): 110295947
Entry
110295947         CDS       T05910                                 

Gene name
Met
Definition
(RefSeq) hepatocyte growth factor receptor isoform X1
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal05100  Bacterial invasion of epithelial cells
mcal05144  Malaria
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05211  Renal cell carcinoma
mcal05218  Melanoma
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295947 (Met)
   04014 Ras signaling pathway
    110295947 (Met)
   04015 Rap1 signaling pathway
    110295947 (Met)
   04020 Calcium signaling pathway
    110295947 (Met)
   04151 PI3K-Akt signaling pathway
    110295947 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110295947 (Met)
   04520 Adherens junction
    110295947 (Met)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110295947 (Met)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295947 (Met)
   05202 Transcriptional misregulation in cancer
    110295947 (Met)
   05206 MicroRNAs in cancer
    110295947 (Met)
   05205 Proteoglycans in cancer
    110295947 (Met)
   05230 Central carbon metabolism in cancer
    110295947 (Met)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110295947 (Met)
   05226 Gastric cancer
    110295947 (Met)
   05218 Melanoma
    110295947 (Met)
   05211 Renal cell carcinoma
    110295947 (Met)
   05223 Non-small cell lung cancer
    110295947 (Met)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110295947 (Met)
  09174 Infectious disease: parasitic
   05144 Malaria
    110295947 (Met)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110295947 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110295947 (Met)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110295947 (Met)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  MET family
   110295947 (Met)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like SKG6
Other DBs
NCBI-GeneID: 110295947
NCBI-ProteinID: XP_021020024
Ensembl: MGP_CAROLIEiJ_G0028118
UniProt: A0A6P5PW78
LinkDB
Position
6
AA seq 1379 aa
MKAPTVLAPGILVLLLTLVQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGH
HIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCLPCQDCSSKANSSGGVWKDNINMAL
LVDTYYDDQLISCGSVNRGTCRRHVLPPDNSADIQSEVHCMFSPEEESGQCPDCVVSALG
AKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEF
QDSYPIKYIHAFESNHFIYFLTVQKETLDAQSFHTRIIRFCSVDSGLHSYMEMPLECILT
EKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPSDDILYGVFAQSKPDSAEPVNRSA
VCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARSDEYRTEFT
TALQRVDLFMGRLNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHFTPHVNFLL
DSHPVSPEVIVEHPSNQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWC
HNQCVRSDECPSGTWTQEICLPAVYKVFPTSAPLEGGTVLTICGWDFGFRKNNKFDLRKT
KVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIISNSRETTQYSAFSYVDPVITS
ISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTISDEFP
VKLKIDLANRETSSFSYREDPVVYEIHPTKSFISGGSTITGIGKTLDSVSLPKLVIAVHE
VGVNYTVACQHRSNSEIICCTTPSLKQLGLQLPLKTKAFFLLDGILSKHFDLTYVHNPVF
EPFEKPVMISMGNENVVEIKGNNIDPEAVKGEVLKVGNQSCESLHWHSGAVLCTVPSDLL
KLNSELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLLSGLFLWMRKRKHK
DLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGACR
QVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNE
VIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNVLSL
LGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVH
RDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHP
KAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEGNT
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgaaggctcccaccgtgctggcacctggcattctggtgctgctgttgaccttggtgcag
aggagccatggggagtgcaaggaggccctagtgaagtctgagatgaacgtgaacatgaag
tatcagctccccaacttcacggcagaaacccccatccagaatgtcgtcctacacggccat
catatttatctcggagccacaaactacatttatgttttaaatgacaaagaccttcagaag
gtatctgaattcaagaccgggcccgtgttggaacacccagattgtttaccttgtcaggac
tgcagcagcaaagccaattcatcaggaggggtttggaaagacaacatcaacatggctctg
cttgttgacacatactatgatgatcaactcattagctgtggcagtgtcaacagagggacc
tgccggcggcatgtccttcctcctgacaattctgctgacatacagtccgaggttcactgc
atgttctccccagaagaagagtcagggcagtgtcctgactgtgtagtgagtgcccttgga
gccaaagtcctcctatcagaaaaggaccgcttcatcaatttctttgtggggaatacgatc
aattcctcctatcctcctggttattcactgcattcaatatcggtgagacggctgaaggaa
acccaagatggttttaagtttttgaccgaccagtcctatattgatgtcttaccagaattc
caagattcctatcccataaagtacatacatgccttcgaaagcaaccattttatttacttt
ctgactgtccaaaaggaaactctagatgctcagagttttcatacaagaataatcaggttc
tgttccgtagactctggattgcactcctacatggaaatgcccctggaatgcattctgaca
gaaaaaagaagaaagagatccacaagggaagaagtgtttaacatcctccaagctgcttat
gtcagtaaaccaggggccaatcttgctaagcaaataggagctagcccttctgatgacatt
ctctacggggtgtttgcacaaagcaagccagattctgctgaacctgtgaatcgatcagca
gtctgtgcattccccatcaaatatgtcaatgacttcttcaacaagattgtcaacaaaaac
aatgtgagatgtctccagcatttttacggacccaaccatgagcactgtttcaataggacc
ctgctgagaaactcttcgggctgtgaggcgcgcagtgacgagtatcggacagagttcacc
acggctttgcagcgcgtcgacttattcatgggccggctcaaccaagtgctcctgacatcc
atctccaccttcatcaaaggtgacctcaccattgctaatctagggacgtcagaaggtcgc
ttcatgcaggtggtgctctctcggacggcacacttcactcctcatgtgaacttcctcctc
gattcccatcctgtatctccagaagtgattgttgagcatccatcaaatcaaaacggctat
acattggttgtcacaggaaagaagatcaccaagattccattgaatggcctgggctgtgga
catttccaatcctgcagtcagtgtctctctgccccttactttatacagtgtggctggtgc
cacaatcaatgtgtgcgttctgatgaatgccccagtggtacatggactcaagagatttgt
ctgccagcagtttataaggtgttccccaccagtgcaccccttgaaggaggaacagtgttg
accatatgtggctgggactttggattcaggaagaataataaatttgatttaaggaaaacc
aaagttctgcttggcaatgagagctgtaccttgaccttaagcgagagcacgacaaatacg
ttgaaatgcacagttggtcccgcgatgagtgagcacttcaatgtgtctgtaattatctca
aacagtcgagagacaacgcaatacagtgcattctcctatgtagatcctgtaataacaagc
atttctccgaggtacggccctcaggctggaggcaccttactcactcttactgggaaatac
ctcaacagtggcaattctagacacatttcaattggagggaaaacatgtactttaaaaagt
gtatcagatagtattcttgaatgctacaccccagcccaaactatctctgatgagtttcct
gtgaaattgaagattgacttggctaaccgagagaccagcagcttcagttaccgggaagac
cccgttgtctatgaaatccacccgaccaaatcttttattagtggtggaagcacaataacg
ggtattgggaagaccctggactcggttagcctcccaaagctggtaatagctgtgcatgaa
gtgggcgtgaactacacagtggcatgtcagcatcgctcaaattcagagatcatctgctgc
actactccttcactgaaacagctgggcctgcaactccccctgaagaccaaagccttcttc
ctgttagacgggattctttccaaacactttgatctcacttatgtgcataatcctgtgttt
gagccttttgaaaagccagtaatgatctcaatgggcaatgaaaatgtagtggaaattaag
ggaaacaatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaatcagagc
tgcgagagtctccactggcactctggagctgtgttgtgtacagtccccagtgacctgctc
aaactgaacagcgagctaaatatagagtggaagcaagcagtctcttcaactgttcttgga
aaagtgatcgttcaaccggatcagaattttgcaggattgatcattggtgcggtctcaata
tcagtagtagttttgttattatccgggctcttcctgtggatgagaaagagaaagcataaa
gatctgggcagtgaattagttcgctatgacgccagagtacacactcctcatttggatagg
cttgtaagtgcccgaagtgtaagtccaactacagagatggtttcaaatgagtctgtagac
tacagagctacttttccagaagaccagtttcccaactcctctcagaatggagcatgcaga
caagtgcaatatcctctgacagacctgtcccctatcctgacgagtggagactctgatata
tccagcccattactacaaaacactgttcacattgacctcagtgccctaaatccagagctg
gtccaagcagttcagcatgtagtgattggacccagcagcctgattgtgcatttcaatgaa
gtcataggaagagggcattttggctgtgtctatcatgggactttgctggacaatgacgga
aagaaaattcactgtgctgtgaaatccttgaatagaatcacagatatagaagaggtctcc
cagtttctgactgagggaatcatcatgaaagacttcagccatcccaatgttctctcactc
ttgggaatctgcctgcggagtgaagggtctcctctagtggtcctgccctatatgaaacat
ggagatcttcgaaatttcattcgaaacgagactcataatccaactgtgaaagatcttata
ggatttggccttcaagtagccaaaggcatgaaatatcttgccagcaaaaagtttgtccac
agagacttagctgcaagaaattgcatgttggatgaaaaattcactgtcaaggttgctgat
ttcggtcttgccagagacatgtatgataaagagtactatagtgtccacaacaagacgggt
gccaagctaccagtcaagtggatggctttagagagtctgcaaacacagaagttcaccacc
aagtcagatgtgtggtcctttggtgtgctcctctgggagctcatgacgagaggagcccct
ccttaccccgacgtgaacacatttgatatcactatctacctgctgcaaggcagaagactc
ttgcagccagaatactgtccagatgccttgtacgaagtgatgctaaaatgctggcacccc
aaagcggaaatgcgcccatccttttctgaactggtctccaggatatcctcaatcttctcc
acgttcattggggaacactacgtccacgtgaacgctacttatgtgaatgtaaaatgtgtt
gctccatatccttctctgttgccatcccaagacaacattgatggcgaggggaacacatga

DBGET integrated database retrieval system