KEGG   Mus caroli (Ryukyu mouse): 110296033
Entry
110296033         CDS       T05910                                 

Gene name
Mitf
Definition
(RefSeq) microphthalmia-associated transcription factor isoform X1
  KO
K09455  microphthalmia-associated transcription factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04137  Mitophagy - animal
mcal04380  Osteoclast differentiation
mcal04916  Melanogenesis
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05218  Melanoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110296033 (Mitf)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110296033 (Mitf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110296033 (Mitf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296033 (Mitf)
   05202 Transcriptional misregulation in cancer
    110296033 (Mitf)
  09162 Cancer: specific types
   05218 Melanoma
    110296033 (Mitf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110296033 (Mitf)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    110296033 (Mitf)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH DUF726
Other DBs
NCBI-GeneID: 110296033
NCBI-ProteinID: XP_021020184
Ensembl: MGP_CAROLIEiJ_G0028681
UniProt: A0A6P5PWJ3
LinkDB
Position
6
AA seq 526 aa
MQSESGIVADFEVGEEFHEEPKTYYELKSQPLKSSSSAEHSGASKPPLSSSTMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVAVSQTPAINVSVPTTLPSATQVPMEVLKVQ
THLENPTKYHIQQAQRHQVKQYLSTTLANKHASQVLSSPCPNQPGDHAMPPVPGSSAPNS
PMAMLTLNSNCEKEAFYKFEEQSRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE
ILGLMDPALQMANTLPVSGNLIDLYSSQGLPPPGLTISNSCPANLPNIKRELTACIFPTE
SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDY
IRKLQREQQRAKDLENRQKKLEHANRHLLLRVQELEMQARAHGLSLIPSTGLCSPDLVNR
IIKQEPVLENCSQELVQHQADLTCTTTLDLTDGTITFTNNLGTMPESSPAYSIPRKMGSN
LEDILMDDALSPVGVTDPLLSSVSPGASKTSSRRSSMSAEETEHAC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcagtcngaatcgggaatcgtggcggatttcgaagtcggggaggagtttcacgaagaa
cccaaaacctattacgaactcaaaagtcaacctctgaagagcagcagttctgcagagcat
tctggggcctccaagcctccgttaagctcctccactatgacatcacgcatcttgctacgc
cagcaactcatgcgtgagcagatgcaggagcaggagcgcagggagcagcagcagaagctg
caggcagcccagttcatgcaacagagagtggccgtgagtcagacaccagccataaacgtc
agcgtgcccaccacccttccctctgccacccaggtgccgatggaagtccttaaggtgcag
acccacctggaaaaccccaccaagtaccacatacagcaagctcagaggcaccaggtaaag
cagtacctttctaccactttagcaaataaacatgccagccaagtcctgagctcaccatgt
ccaaaccagcctggcgaccatgccatgccaccagtgccggggagcagcgcacccaacagc
cctatggctatgctcactcttaactccaactgtgaaaaagaggcattttataagtttgag
gagcagagcagggcagagagtgagtgcccaggtatgaacacgcactctcgagcgtcgtgc
atgcagatggatgatgtaattgatgacatcatcagcctggaatcaagttataatgaagaa
attttgggcttgatggatccggccttgcaaatggcaaatacgttacctgtctctggaaac
ttgatcgacctctatagcagccagggcctgccgccgccaggccttaccatcagcaactcc
tgtccagccaaccttcccaacataaaaagggagctcacagcgtgtattttccccacagag
tctgaagcaagagcattggctaaagagaggcagaaaaaggacaatcacaacttgattgaa
cgaagaagaagatttaacataaacgaccgcattaaggagctaggtactttgatccccaag
tcaaatgatccagacatgcggtggaacaagggaaccattctcaaggcctctgtggactac
atccggaagttgcaacgggaacagcaacgagctaaggaccttgaaaaccggcagaagaag
ctggagcatgcgaaccggcacctgctgctcagagtacaggagctggagatgcaggctaga
gcacacggactttcccttatcccatccaccggtctctgctcgcctgatctggtgaatcgg
atcatcaagcaagaaccagttcttgagaactgcagccaggaacttgtacagcaccaggca
gacctgacgtgtacgacaactctggatctcacggacggtaccatcacctttaccaacaac
ctcggcaccatgccagagagcagcccggcctacagcatccccaggaagatgggctccaac
ttggaagacatcctgatggacgatgccctctcaccagttggtgtcaccgacccactgctg
tcatcagtgtctccaggagcttcaaaaacaagcagccggaggagcagtatgagcgcagaa
gaaacggagcatgcgtgttag

DBGET integrated database retrieval system