KEGG   Mus caroli (Ryukyu mouse): 110296136
Entry
110296136         CDS       T05910                                 

Gene name
Vhl
Definition
(RefSeq) von Hippel-Lindau disease tumor suppressor
  KO
K03871  von Hippel-Lindau disease tumor supressor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04066  HIF-1 signaling pathway
mcal04120  Ubiquitin mediated proteolysis
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110296136 (Vhl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110296136 (Vhl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296136 (Vhl)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110296136 (Vhl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110296136 (Vhl)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     110296136 (Vhl)
SSDB
Motif
Pfam: VHL VHL_C Arm_vescicular
Other DBs
NCBI-GeneID: 110296136
NCBI-ProteinID: XP_021020347
Ensembl: MGP_CAROLIEiJ_G0028736
UniProt: A0A6P5PUC5
LinkDB
Position
6
AA seq 181 aa
MPRKAASPEEAAGESGPEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPLWLNFDGE
PQPYPILPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLP
VYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPSVRKDIQRLSQEHLESQHLEEE
P
NT seq 546 nt   +upstreamnt  +downstreamnt
atgccccggaaggcagccagtccagaggaggcggcgggggagtcgggtcctgaggagatg
gaggctgggcggccgcggccggtgctgcgctcggtgaactcgcgcgagccctctcaggtt
atcttctgcaaccgcagcccgcgcgtcgtgctgcctttgtggctcaacttcgatggcgag
cctcagccctacccgatcttaccaccgggcaccggccgccgcatccacagctaccgaggt
catctttggctcttcagggatgcggggacccatgatggacttctggttaaccaaacggaa
ctgtttgtgccatccctcaatgttgatggacagcctatttttgccaacatcacattgcca
gtgtataccctgaaagagcggtgccttcaggttgtgcggagcctggtcaagcccgagaac
tacaggaggctggacatcgtcaggtcgctctatgaggatttggaagaccacccaagtgtg
cggaaggacatacagcgactgagccaagagcaccttgagagtcagcacctggaagaggag
ccttga

DBGET integrated database retrieval system