KEGG   Mus caroli (Ryukyu mouse): 110296194
Entry
110296194         CDS       T05910                                 

Gene name
Kras
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04062  Chemokine signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04137  Mitophagy - animal
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04625  C-type lectin receptor signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04714  Thermogenesis
mcal04720  Long-term potentiation
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04929  GnRH secretion
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05034  Alcoholism
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110296194 (Kras)
   04012 ErbB signaling pathway
    110296194 (Kras)
   04014 Ras signaling pathway
    110296194 (Kras)
   04015 Rap1 signaling pathway
    110296194 (Kras)
   04370 VEGF signaling pathway
    110296194 (Kras)
   04371 Apelin signaling pathway
    110296194 (Kras)
   04068 FoxO signaling pathway
    110296194 (Kras)
   04072 Phospholipase D signaling pathway
    110296194 (Kras)
   04071 Sphingolipid signaling pathway
    110296194 (Kras)
   04151 PI3K-Akt signaling pathway
    110296194 (Kras)
   04150 mTOR signaling pathway
    110296194 (Kras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110296194 (Kras)
   04137 Mitophagy - animal
    110296194 (Kras)
  09143 Cell growth and death
   04210 Apoptosis
    110296194 (Kras)
   04218 Cellular senescence
    110296194 (Kras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110296194 (Kras)
   04550 Signaling pathways regulating pluripotency of stem cells
    110296194 (Kras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110296194 (Kras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110296194 (Kras)
   04650 Natural killer cell mediated cytotoxicity
    110296194 (Kras)
   04660 T cell receptor signaling pathway
    110296194 (Kras)
   04662 B cell receptor signaling pathway
    110296194 (Kras)
   04664 Fc epsilon RI signaling pathway
    110296194 (Kras)
   04062 Chemokine signaling pathway
    110296194 (Kras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110296194 (Kras)
   04929 GnRH secretion
    110296194 (Kras)
   04912 GnRH signaling pathway
    110296194 (Kras)
   04915 Estrogen signaling pathway
    110296194 (Kras)
   04914 Progesterone-mediated oocyte maturation
    110296194 (Kras)
   04917 Prolactin signaling pathway
    110296194 (Kras)
   04921 Oxytocin signaling pathway
    110296194 (Kras)
   04926 Relaxin signaling pathway
    110296194 (Kras)
   04935 Growth hormone synthesis, secretion and action
    110296194 (Kras)
   04919 Thyroid hormone signaling pathway
    110296194 (Kras)
   04916 Melanogenesis
    110296194 (Kras)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110296194 (Kras)
  09156 Nervous system
   04725 Cholinergic synapse
    110296194 (Kras)
   04726 Serotonergic synapse
    110296194 (Kras)
   04720 Long-term potentiation
    110296194 (Kras)
   04730 Long-term depression
    110296194 (Kras)
   04722 Neurotrophin signaling pathway
    110296194 (Kras)
  09158 Development and regeneration
   04360 Axon guidance
    110296194 (Kras)
  09149 Aging
   04211 Longevity regulating pathway
    110296194 (Kras)
   04213 Longevity regulating pathway - multiple species
    110296194 (Kras)
  09159 Environmental adaptation
   04714 Thermogenesis
    110296194 (Kras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296194 (Kras)
   05206 MicroRNAs in cancer
    110296194 (Kras)
   05205 Proteoglycans in cancer
    110296194 (Kras)
   05203 Viral carcinogenesis
    110296194 (Kras)
   05230 Central carbon metabolism in cancer
    110296194 (Kras)
   05231 Choline metabolism in cancer
    110296194 (Kras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110296194 (Kras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110296194 (Kras)
   05212 Pancreatic cancer
    110296194 (Kras)
   05225 Hepatocellular carcinoma
    110296194 (Kras)
   05226 Gastric cancer
    110296194 (Kras)
   05214 Glioma
    110296194 (Kras)
   05216 Thyroid cancer
    110296194 (Kras)
   05221 Acute myeloid leukemia
    110296194 (Kras)
   05220 Chronic myeloid leukemia
    110296194 (Kras)
   05218 Melanoma
    110296194 (Kras)
   05211 Renal cell carcinoma
    110296194 (Kras)
   05219 Bladder cancer
    110296194 (Kras)
   05215 Prostate cancer
    110296194 (Kras)
   05213 Endometrial cancer
    110296194 (Kras)
   05224 Breast cancer
    110296194 (Kras)
   05223 Non-small cell lung cancer
    110296194 (Kras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110296194 (Kras)
   05022 Pathways of neurodegeneration - multiple diseases
    110296194 (Kras)
  09165 Substance dependence
   05034 Alcoholism
    110296194 (Kras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110296194 (Kras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110296194 (Kras)
   05170 Human immunodeficiency virus 1 infection
    110296194 (Kras)
   05161 Hepatitis B
    110296194 (Kras)
   05160 Hepatitis C
    110296194 (Kras)
   05163 Human cytomegalovirus infection
    110296194 (Kras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110296194 (Kras)
   05165 Human papillomavirus infection
    110296194 (Kras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110296194 (Kras)
   01522 Endocrine resistance
    110296194 (Kras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110296194 (Kras)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mcal04031]
    110296194 (Kras)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110296194 (Kras)
GTP-binding proteins [BR:mcal04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110296194 (Kras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin CbiA ParA AAA_25
Other DBs
NCBI-GeneID: 110296194
NCBI-ProteinID: XP_021020441
Ensembl: MGP_CAROLIEiJ_G0029047
UniProt: A0A6P5PQ68
LinkDB
Position
6
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCVIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgagaactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaggactctgaagatgtgcctatggtcctggtagggaataagtgtgatttg
ccttctagaacagtagacacgaaacaggctcaggagttagcaaggagttacgggattccg
ttcattgagacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcgttataatgtaa

DBGET integrated database retrieval system