KEGG   Mus caroli (Ryukyu mouse): 110296205
Entry
110296205         CDS       T05910                                 

Gene name
Tnfrsf1a
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04061  Viral protein interaction with cytokine and cytokine receptor
mcal04064  NF-kappa B signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04150  mTOR signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04380  Osteoclast differentiation
mcal04668  TNF signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal05010  Alzheimer disease
mcal05014  Amyotrophic lateral sclerosis
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110296205 (Tnfrsf1a)
   04064 NF-kappa B signaling pathway
    110296205 (Tnfrsf1a)
   04668 TNF signaling pathway
    110296205 (Tnfrsf1a)
   04071 Sphingolipid signaling pathway
    110296205 (Tnfrsf1a)
   04150 mTOR signaling pathway
    110296205 (Tnfrsf1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110296205 (Tnfrsf1a)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110296205 (Tnfrsf1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110296205 (Tnfrsf1a)
   04215 Apoptosis - multiple species
    110296205 (Tnfrsf1a)
   04217 Necroptosis
    110296205 (Tnfrsf1a)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110296205 (Tnfrsf1a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110296205 (Tnfrsf1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110296205 (Tnfrsf1a)
   05014 Amyotrophic lateral sclerosis
    110296205 (Tnfrsf1a)
   05022 Pathways of neurodegeneration - multiple diseases
    110296205 (Tnfrsf1a)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110296205 (Tnfrsf1a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110296205 (Tnfrsf1a)
   04931 Insulin resistance
    110296205 (Tnfrsf1a)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110296205 (Tnfrsf1a)
   05152 Tuberculosis
    110296205 (Tnfrsf1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110296205 (Tnfrsf1a)
   05170 Human immunodeficiency virus 1 infection
    110296205 (Tnfrsf1a)
   05160 Hepatitis C
    110296205 (Tnfrsf1a)
   05171 Coronavirus disease - COVID-19
    110296205 (Tnfrsf1a)
   05164 Influenza A
    110296205 (Tnfrsf1a)
   05168 Herpes simplex virus 1 infection
    110296205 (Tnfrsf1a)
   05163 Human cytomegalovirus infection
    110296205 (Tnfrsf1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110296205 (Tnfrsf1a)
   05165 Human papillomavirus infection
    110296205 (Tnfrsf1a)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110296205 (Tnfrsf1a)
   05142 Chagas disease
    110296205 (Tnfrsf1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcal04050]
    110296205 (Tnfrsf1a)
   04090 CD molecules [BR:mcal04090]
    110296205 (Tnfrsf1a)
Cytokine receptors [BR:mcal04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   110296205 (Tnfrsf1a)
CD molecules [BR:mcal04090]
 Proteins
  110296205 (Tnfrsf1a)
SSDB
Motif
Pfam: TNFR_c6 Death DUF4880
Other DBs
NCBI-GeneID: 110296205
NCBI-ProteinID: XP_021020453
Ensembl: MGP_CAROLIEiJ_G0028880
UniProt: A0A6P5Q1S1
LinkDB
Position
6
AA seq 452 aa
MGLPTVPGLLLSLVLLALLMGIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNSSICCT
KCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNHLRQCLSCKTCRKEMSQVEISPCQAD
KDTVCGCKKNQFQRYLSETHFLCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECV
PCSHCKKNQECMKLCLPPSLANVTNPQDSGTAVLLPLVILLGLCLLSFIFISLMCRYPRW
RSVVYSIICRDSVPVKEEKAGKPLTPAPSPAFTPTSSFNPILGFSTPGFSPPVSSTPISP
IFGPSNWHFMPPVSEVVPTQGADPLLYESLCSVPAPTSVQKWEDSAHPQRPDNADLLYAV
VDGVPPTRWKEFMRFMGLSEHEIERLEMQNGRYLREAQYSMLEAWRRRTPRHEDTLEVVG
LVLSKMNLTGCLENILEALRNPAPSSTTRLPR
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgggtctccccaccgtgcctggcctgctgctgtcactggtgctcctggctctgctgatg
gggatacatccatcaggggtcactggactagtcccttctcttggtgaccgggagaagagg
gatagcttgtgtccccaaggaaagtatgtccattctaagaacagttccatctgctgcacc
aagtgccacaaaggaacctacttggtgagtgactgtccgagcccagggcgggatacagtc
tgcagggagtgtgaaaagggcacctttacggcttcccagaaccacctcagacagtgtctc
agttgcaagacgtgtcggaaagaaatgtcccaggtggagatctctccttgccaagctgac
aaggacacngtgtgtggctgtaagaagaaccagttccaacgttacctgagtgagacgcac
ttcctgtgcgtggactgcagcccctgcttcaacggcaccgtgacaatcccctgtaaggag
actcagaacactgtgtgtaactgccatgcggggttctttctaagagaaagtgaatgcgtc
ccttgcagccactgcaagaaaaatcaggagtgtatgaagttgtgcctacctccttcgctt
gcaaatgtcacaaacccccaggactcaggtactgcggtgctgttgcccctggttatcttg
ctaggtctttgccttctgtcctttatcttcatcagtttaatgtgccgatatccccggtgg
aggtccgtagtctactccatcatttgtagggattccgtgcctgtcaaagaggagaaggct
ggaaagcccctaactccagccccctccccagccttcacccccacctccagcttcaacccc
attctgggcttcagcaccccaggctttagtcctcctgtctccagtacccccatcagcccc
atctttggtcctagtaactggcacttcatgccacctgtcagtgaggtagtcccaacccag
ggtgctgaccctctgctctacgaatcactctgctccgtgccagcccccacctctgttcag
aaatgggaagactccgcccacccgcaacgtcctgacaatgcagaccttctgtatgctgtg
gtggatggcgtgcctccaacgcgctggaaggagttcatgcgttttatggggctgagcgag
cacgagatcgagaggctggagatgcagaacgggcgctacctgcgcgaggctcagtacagc
atgctggaagcctggcggcgccgcacgccgcgccacgaggacacgctggaagtagtgggc
ctcgtgctttccaagatgaacctgactgggtgcctggagaatatcctggaggctctgaga
aatcccgccccctcgtccacgacccgcctcccgcgataa

DBGET integrated database retrieval system