KEGG   Mus caroli (Ryukyu mouse): 110296267
Entry
110296267         CDS       T05910                                 

Gene name
Hk2
Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00010  Glycolysis / Gluconeogenesis
mcal00051  Fructose and mannose metabolism
mcal00052  Galactose metabolism
mcal00500  Starch and sucrose metabolism
mcal00520  Amino sugar and nucleotide sugar metabolism
mcal00524  Neomycin, kanamycin and gentamicin biosynthesis
mcal01100  Metabolic pathways
mcal01200  Carbon metabolism
mcal04066  HIF-1 signaling pathway
mcal04910  Insulin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04973  Carbohydrate digestion and absorption
mcal05230  Central carbon metabolism in cancer
Module
mcal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcal_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
mcal_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110296267 (Hk2)
   00051 Fructose and mannose metabolism
    110296267 (Hk2)
   00052 Galactose metabolism
    110296267 (Hk2)
   00500 Starch and sucrose metabolism
    110296267 (Hk2)
   00520 Amino sugar and nucleotide sugar metabolism
    110296267 (Hk2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110296267 (Hk2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110296267 (Hk2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110296267 (Hk2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110296267 (Hk2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    110296267 (Hk2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110296267 (Hk2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110296267 (Hk2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110296267 (Hk2)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110296267 (Hk2)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Other DBs
NCBI-GeneID: 110296267
NCBI-ProteinID: XP_021020535
Ensembl: MGP_CAROLIEiJ_G0028531
UniProt: A0A6P5PXC2
LinkDB
Position
6
AA seq 917 aa
MIASHMIACLFTELNQNQVQKVDQYLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV
EGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEDDKDGIQKAYQILVRLG
LSPLQEDCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKH
PHFAKRLHKAVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLESLKLS
HEQLLEVKRRMKVEMEQGLSKETHEAAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVDGEEGRMCVNMEWGAFGDNGCLDD
LRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILRHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLAPKCDVSFLESEDGSGKG
AALITAVACRIREAGQR
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgatcgcctcgcatatgatcgcctgcttattcacggagctcaaccaaaaccaagtgcag
aaggttgaccagtatctctaccacatgcgtctctcagatgagacccttctggagatttct
aggcggttccggaaggagatggagaaggggctaggagctactacgcaccctacagcagct
gtgaagatgctgcccacctttgtgaggtcaactccagatgggacagaacatggcgagttc
ctggctctggaccttggaggaaccaactttcgtgtgctccgagtaagggtgacagacaat
ggtctccagagggtggagatggagaaccagatctacgccattcccgaggacatcatgcgg
ggcagtggaacccagctgtttgaccacattgccgaatgcctggccaacttcatggacaag
ctacagatcaaagagaagaagctcccgctgggcttcaccttctcgttcccctgccaccag
acgaaactggatgagagtttcttggtctcatggactaaggggttcaagtccagtggtgtg
gaaggcagagatgtggtggatctgatccggaaggccatccagcgcagaggggactttgac
attgacattgtggctgtggtgaatgacacggttgggaccatgatgacgtgtggttatgat
gatcagaactgcgagattggtctcattgtgggtactggcagtaatgcctgctacatggag
gagatgcgtcacattgacatggtggagggcgacgagggacggatgtgcatcaacatggag
tggggggcctttggggacgacggtacactcaatgacatccgaactgagtttgaccgagag
atcgacatgggctcactgaaccccgggaagcagctgtttgagaagatgatcagcgggatg
tacatgggggagttggtcaggctcatcctggtgaagatggccaaggctgagctgctgttc
caagggaaactcagcccagagctccttaccactggctccttcgagaccaaagatgtctcg
gatattgaagacgataaggacggaatccagaaggcctaccagatcctggtgcgcctgggt
ctgagcccgctgcaggaggactgtgtggccacgcaccgaatctgccagattgtgtccacg
cgctcggccagtctgtgtgcagccaccctggccgcagtgctgtggcggatcaaagagaac
aagggcgaggagcgactccgctccaccatcggcgtggatggctctgtctacaagaaacat
ccccattttgccaagcgtctccataaggcagtgaggaggctggtgcccgattgtgatgtc
cgcttcctccgctctgaggatggcagcggcaagggggcggctatggtgacggcggtggct
taccgtctggctgaccaacaccgggcccgccagaagaccctggagtctctgaagctgagc
catgaacagctgctggaggttaagagaaggatgaaggtggaaatggagcagggtctgagc
aaggagacgcacgaggccgcccctgtgaagatgctgcccacttatgtgtgtgccactcca
gacggtacagagaaaggagacttcctggccttggatcttggaggaacaaacttccgggtc
ctgctggtgcgcgtgcgtaatggcaagcgaaggggcgtagagatgcataacaagatctac
tccatcccgcaggaggtcatgcatggcactggagaagagcttttcgaccacattgtccag
tgcatcgcggacttccttgaatacatgggcatgaagggcgtgtccctacctttgggtttc
accttctccttcccttgccagcagaacagcctggaccagagcatcctcctcaagtggaca
aagggattcaaggcatctggctgcgagggcgaggatgtggtcaccttgctgaaggaagcc
attcaccggcgagaggagttcgacctggatgtggtggccgtggtgaatgacacagttggg
actatgatgacttgtggctatgaagaccctcactgtgaagttggcctcattgttggcact
ggaagcaatgcctgctacatggaggagatgcgtaatgtggagttggtggacggagaggag
ggacggatgtgtgtcaacatggagtggggagcgttcggggacaacggctgcctggatgac
ctgcgcacagtgtttgatgtcgctgtggacgagctctctctcaaccctggcaaacagagg
tttgagaagatgatcagcggcatgtacttgggcgagattgtgcgcaacatcctcatcgat
ttcacaaagcgggggctgctcttccggggccgcatctcagagcgcctcaagacaagggga
atctttgaaactaagttcctgtctcagatcgagagtgactgcctggccctgctacaggtc
cgagccatcctgcgccacctagggctggagagcacgtgtgacgacagcatcattgtgaag
gaggtgtgcactgtggtcgcccggcgtgcggcccagctctgtggcgcaggcatggctgcc
gtggtggacaagataagagagaaccgcggactggacaatctcaaagtgacggtgggcgtg
gacgggacactgtacaagcttcatcctcactttgccaaagtcatgcatgagacggtgaga
gatctggctccgaaatgtgacgtgtccttcctggaatccgaggatggcagtgggaaggga
gcagctctcatcactgctgtggcctgccgcatccgggaggccgggcagagatag

KEGG   Mus caroli (Ryukyu mouse): 110302692
Entry
110302692         CDS       T05910                                 

Gene name
Hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00010  Glycolysis / Gluconeogenesis
mcal00051  Fructose and mannose metabolism
mcal00052  Galactose metabolism
mcal00500  Starch and sucrose metabolism
mcal00520  Amino sugar and nucleotide sugar metabolism
mcal00524  Neomycin, kanamycin and gentamicin biosynthesis
mcal01100  Metabolic pathways
mcal01200  Carbon metabolism
mcal04066  HIF-1 signaling pathway
mcal04910  Insulin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04973  Carbohydrate digestion and absorption
mcal05230  Central carbon metabolism in cancer
Module
mcal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcal_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
mcal_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110302692 (Hk1)
   00051 Fructose and mannose metabolism
    110302692 (Hk1)
   00052 Galactose metabolism
    110302692 (Hk1)
   00500 Starch and sucrose metabolism
    110302692 (Hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    110302692 (Hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110302692 (Hk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110302692 (Hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110302692 (Hk1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110302692 (Hk1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    110302692 (Hk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110302692 (Hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110302692 (Hk1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110302692 (Hk1)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110302692 (Hk1)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 110302692
NCBI-ProteinID: XP_021029133
Ensembl: MGP_CAROLIEiJ_G0015381
LinkDB
Position
10
AA seq 924 aa
MGWGAPLLSRMLHGPEQAGEASPVPERQSGSENPASEDRRPLEKQRSHHLYTMGQNCQKG
QAVDVEPKIRPPLTEEKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTASVKML
PTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVHGSGS
QLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGAD
VVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRH
IDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGE
LVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETGSTLSPGRRWYQAYMRRTQD
THRDKEGVQNAKEILTRLGVEPSHDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNK
GTPRLRTTVGVDGSLYKMHPQIQKEEKRVLPLSSVTRTIGFFSVFFLVTEHGDFLALDLG
GTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGP
RMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAV
VNDTVGTMMTCAYEEPTCEIGLIVGTGSNACYMEEMKNVEMVEGNQGQMCINMEWGAFGD
NGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISE
PLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLC
GAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSE
DGSGKGAALITAVGVRLRGDPTNA
NT seq 2775 nt   +upstreamnt  +downstreamnt
atgggatggggagcaccacttctctctaggatgctgcatggtccagaacaggctggggaa
gctagccctgtgccagaaaggcagtcaggatcagaaaaccccgcttctgaggacagaaga
cccttggaaaaacagcgtagccatcacctctacactatgggacagaactgccagaaagga
caggctgtagatgttgaaccaaaaatacgaccccctctcacagaggaaaagattgataag
tatctgtatgccatgcggctctctgatgaaattctgatagatatcctgacacgcttcaag
aaggagatgaagaatggcctctcccgggactataacccaacagcctccgtcaagatgctg
ccgacctttgtccggtccattccggatggctcagaaaagggggatttcattgcactggat
ctcggcgggtcttcctttcgaatcctgcgggtgcaggtgaaccacgagaagagtcagaac
gtcagcatggagtctgaggtctacgacaccccagagaacatcgtgcacggcagtggaagc
cagctttttgatcacgtcgctgaatgcctcggagacttcatggagaaaaggaagatcaag
gacaagaaattacccgtgggattcacgttttccttcccgtgccgacaatccaaaatagac
gaggctgtactgatcacgtggacaaagcggttcaaagccagtggcgtggaaggggcggat
gtggtcaagctgctgaataaagccattaagaagcgaggggactatgatgctaacattgta
gctgtggtgaatgacacggtggggaccatgatgacctgcggctacgatgaccaacagtgt
gaagtcggcctgatcattggcacaggcaccaatgcttgctacatggaggaactgcgacac
atcgacctggtggaaggcgatgaggggaggatgtgtattaacacggaatggggagccttt
ggggacgatgggtccctggaagacatccgaactgagtttgacagagagttagaccgggga
tccctcaaccctgggaaacagctgttcgagaagatggtgagcggcatgtacatgggagag
ctggtccggctgatcctggtgaagatggccaaggaaagtctcttatttgaagggcgcatt
actccagagctgctcacgaggggcaagttcaccactagcgacgtagccgccattgaaacg
ggatcgacactctcccctggccgcaggtggtaccaggcatatatgaggcgcacacaagac
acccatagggataaggaaggcgttcaaaatgccaaggaaatcttgacccgcctgggagtg
gagccatctcacgatgactgtgtatcggtccagcacgtatgcacaatcgtgtccttccga
tcagccaacctggtggctgccacgctcggtgccatcttgaaccgcctgcgggacaataag
ggcacgcccaggctgcggaccacagttggcgtagacggttctctctacaagatgcaccca
caaatccaaaaagaagagaagcgggttcttccattgtcttcagtgacaagaaccataggc
tttttctctgtgttcttccttgtgacagagcatggtgacttcctggccttggatctcgga
ggaacgaatttccgagtcctactggtaaagatccgtagtgggaaaaagagaacagtggag
atgcacaacaagatctactccattcccctggaaatcatgcagggcaccggggatgagctg
tttgaccacattgtctcctgcatctccgacttcctggactacatggggatcaaaggcccc
cggatgcctctgggcttcaccttctcgtttccctgcaagcagaccagcctagattgcgga
atcttgatcacgtggacaaagggattcaaagccaccgactgtgtgggtcacgatgtagcc
actttactgagggatgctgtaaaaaggagagaggaatttgacctggatgtggtggctgtg
gtcaacgacactgtgggcaccatgatgacttgtgcttatgaagaacccacttgtgagatt
ggactcatcgtggggactggcagcaatgcctgctacatggaggagatgaagaacgtggag
atggtagaggggaaccagggccagatgtgcatcaatatggagtggggtgcctttggtgac
aatggctgtctggacgacatcagaacagacttcgacaaagtggtggacgaatattctcta
aacagtgggaaacaaaggtttgagaagatgatcagtggaatgtacctgggtgagatcgtc
cgtaacatcctgattgacttcaccaagaaaggcttcctcttccggggacagatctctgag
ccactcaagacccgaggcatcttcgagaccaagtttctctctcagatcgagagtgaccga
ttagcgctgctccaggtgcgggccatccttcagcagctgggtctgaacagcacgtgcgac
gacagtatcctggtcaagaccgtgtgtggggtggtgtccaagcgggcggcccagctgtgt
ggtgccggcatggccgccgtggtggaaaagatccgagagaacagaggcctagaccacctg
aatgtaactgtgggcgtggacgggacgctctacaaactccatccacatttctccagaatc
atgcaccaaacagtgaaggaactgtcaccaaagtgtaccgtgtccttccttctgtctgaa
gacggcagcggcaagggggctgcccttatcacagctgtgggcgtgcggctcagaggagac
cctacgaacgcctaa

KEGG   Mus caroli (Ryukyu mouse): 110303354
Entry
110303354         CDS       T05910                                 

Gene name
Hkdc1
Definition
(RefSeq) putative hexokinase HKDC1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00010  Glycolysis / Gluconeogenesis
mcal00051  Fructose and mannose metabolism
mcal00052  Galactose metabolism
mcal00500  Starch and sucrose metabolism
mcal00520  Amino sugar and nucleotide sugar metabolism
mcal00524  Neomycin, kanamycin and gentamicin biosynthesis
mcal01100  Metabolic pathways
mcal01200  Carbon metabolism
mcal04066  HIF-1 signaling pathway
mcal04910  Insulin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04973  Carbohydrate digestion and absorption
mcal05230  Central carbon metabolism in cancer
Module
mcal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcal_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
mcal_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110303354 (Hkdc1)
   00051 Fructose and mannose metabolism
    110303354 (Hkdc1)
   00052 Galactose metabolism
    110303354 (Hkdc1)
   00500 Starch and sucrose metabolism
    110303354 (Hkdc1)
   00520 Amino sugar and nucleotide sugar metabolism
    110303354 (Hkdc1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110303354 (Hkdc1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110303354 (Hkdc1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110303354 (Hkdc1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110303354 (Hkdc1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    110303354 (Hkdc1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110303354 (Hkdc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110303354 (Hkdc1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110303354 (Hkdc1)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110303354 (Hkdc1)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 VPS13_mid_rpt CSD
Other DBs
NCBI-GeneID: 110303354
NCBI-ProteinID: XP_021030110
Ensembl: MGP_CAROLIEiJ_G0015382
UniProt: A0A6P5QJM0
LinkDB
Position
10
AA seq 915 aa
MFAVHLVAFYFTKLKEDQIKKVDRFLYHMRLSDETLVDIMARFQAEMEKGLGKDTNPTAS
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSQEGQQNVQMESQFYPMPNEITR
GNGTELFDYVADCLADFMKTKDLTHKKLPLGFTFSFPCRQNKLEEGVLLSWTKKFKARGV
QDTDVVNRLATAMKKHKDLDVDILALVNDTVGTMMTCAYDDPNCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPRKQLFEKMISGL
YMGELVRLILLKMAKVGLLFGGAKSSALHTKGKIETQHVAAMEMSKEGLANTREILVDLG
LEPSESDCIAVQHVCTIVSFRSANLCAAALATILTRLRENKKLARLRTTVGMDGTLYKTH
PQYPKRLHKVVRRLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFQLT
REQLLGVRDKMRAELEYGLKKKTHSLATVKMLPTYVYGMPDGTEKGKFLALDLGGTNFRV
LLVKIRRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFTFS
FPCRQTCIDKGTLVGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAIVNDTVGTMM
TCGYEDPRCEIGLIAGTGSNVCYMEEMRNIELVDGDEGRMCVNTEWGGFGDNGCIDDIRT
QYDKEVDDGSLNAGKQRYEKMTSGMYLGEIVRRILIDLTRQGLLFRGQISERLRTRGIFE
TKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQMCGAGMAAIVE
KRREDQGLQHFKVTVGVDGTLYKLHPHFSRILQETVKELAPQCDVTFMLSEDGSGKGAAL
ITAVAKRLQQPRKDI
NT seq 2748 nt   +upstreamnt  +downstreamnt
atgtttgcagtacacttggtggcgttttacttcaccaagctgaaggaggaccagatcaag
aaggtggacaggttcctgtatcacatgcggctctcggatgagaccctggtggacatcatg
gcccgcttccaggccgagatggagaaaggcttggggaaggacaccaaccccactgcctct
gtgaagatgctgcccacgtttgtcagggccattccagatggctcagaaaacggggaattc
ctttccctggatctcggaggatccaagtttcgggtcttgaaggtgcaagtctcccaagag
ggccagcaaaatgttcagatggagagccagttctacccaatgcccaatgaaatcacccgt
gggaatggcacggagctctttgactacgtagccgactgcctggcagatttcatgaagacc
aaagatctgacgcataagaagctgcctctgggcttcaccttttcttttccctgcagacag
aataagttggaggagggtgttctgctttcgtggaccaagaagttcaaggcccggggagtt
caggacacagacgtggtgaaccgcctggccactgccatgaagaagcacaaggacctggat
gtggacatcctggctttggttaacgacactgtggggaccatgatgacttgtgcttatgat
gatcccaactgtgaagtcggcgttatcatcggaacaggcaccaacgcgtgttacatggag
gacatgagcaacatcgacctcgtggaaggggacgagggaaggatgtgtatcaacacggag
tggggggccttcggggacgatggggctttggaggacatccgtaccgagtttgacagagag
ctggacctgggctcgctcaaccccaggaagcagctgttcgagaagatgatcagcgggctg
tacatgggggagctggtcaggcttatcttgctgaagatggccaaagttggtctcctgttt
gggggtgcaaaatcctccgctctccatacaaagggcaagatcgaaacacagcacgtggct
gccatggagatgagtaaagaaggcctggccaacacgcgagagatcctggtggatttgggc
ctggagccctctgagtcagactgcattgctgtccagcatgtgtgcaccatcgtctctttt
cgctcagccaatctctgcgcggcggcactggcaaccatcctgacgcgcctccgagagaac
aagaagctggcccggctccgcaccacagtgggcatggatggaactctctacaagacacac
cctcagtaccccaaacgcctacacaaggtggtgaggagactggtcccaaactgtgatgtc
cgcttcctcctgtcagagagcggaagcaccaagggggctgccatggtgaccgcagtggcc
tctcgggtacaggcccagcgcaagcagatcgacaaggtgctagctttgttccagttgacc
cgagagcaactcctgggtgtgcgggacaagatgagggctgaactagagtacgggctgaag
aaaaagacccactctctggctaccgtgaagatgcttcccacctatgtctacgggatgccg
gatggcacagagaaaggaaagttccttgccctggatttggggggaaccaacttccgagtc
ctcctggtgaagatcaggcggaggtctgtgcgcatgtacaacaagatcttcgccatccct
ctggagatcatgcagggcactggggaggaactctttgaccacatcgtacagtgcatcgct
gacttcctggactacatgggcctcaagggcgcccagctgcctttgggcttcaccttctcc
ttcccctgcagacagacatgcatcgacaaggggactctagtagggtggaccaaaggcttc
aaggccaccgactgtgaaggggaggatgtggtggacatgctcagagaagccatcaagagg
agaaatgagtttgacctggacattgttgcaatcgtgaacgacacggtggggaccatgatg
acctgtggctatgaagatcccaggtgtgagattggcttgattgcagggacaggaagcaac
gtgtgctacatggaggaaatgaggaatatcgagctggtggacggggacgaaggccggatg
tgcgttaacacagagtggggcgggtttggtgacaatggctgcattgatgacatccgcacc
cagtacgacaaggaggtggatgacggctccctcaacgccggcaagcagagatacgagaaa
atgaccagtgggatgtacctgggggagattgtgaggcggatcttgatcgacctcacccgg
caggggctcctcttccgagggcagatttcagagcgactccggaccaggggcatctttgaa
accaaattcctgtcccagattgaaagtgaccggctggccctcctgcaggtcaggaggatc
ctgcagcagctgggcctggacagcacatgcgaagacagtattgtggtgaaggaggtgtgt
ggggctgtgtctcggagggccgcccagatgtgtggcgccggcatggctgccatcgtggag
aagaggagagaagaccagggcctccagcacttcaaggtcaccgtgggcgtggatggcaca
ctgtacaagctgcacccacacttctcccggatactgcaggagacggtgaaagagctggcc
cctcagtgtgatgtgacatttatgttgtcagaagacggcagcgggaagggagcagctctg
atcacagctgtagccaagaggttacagcagccacggaaggacatctag

KEGG   Mus caroli (Ryukyu mouse): 110305090
Entry
110305090         CDS       T05910                                 

Gene name
Gck
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00010  Glycolysis / Gluconeogenesis
mcal00052  Galactose metabolism
mcal00500  Starch and sucrose metabolism
mcal00520  Amino sugar and nucleotide sugar metabolism
mcal00524  Neomycin, kanamycin and gentamicin biosynthesis
mcal01100  Metabolic pathways
mcal01200  Carbon metabolism
mcal04910  Insulin signaling pathway
mcal04911  Insulin secretion
mcal04917  Prolactin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04930  Type II diabetes mellitus
mcal04950  Maturity onset diabetes of the young
mcal05230  Central carbon metabolism in cancer
Module
mcal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcal_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
mcal_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110305090 (Gck)
   00052 Galactose metabolism
    110305090 (Gck)
   00500 Starch and sucrose metabolism
    110305090 (Gck)
   00520 Amino sugar and nucleotide sugar metabolism
    110305090 (Gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110305090 (Gck)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110305090 (Gck)
   04910 Insulin signaling pathway
    110305090 (Gck)
   04922 Glucagon signaling pathway
    110305090 (Gck)
   04917 Prolactin signaling pathway
    110305090 (Gck)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    110305090 (Gck)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110305090 (Gck)
   04950 Maturity onset diabetes of the young
    110305090 (Gck)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     110305090 (Gck)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 110305090
NCBI-ProteinID: XP_021032531
Ensembl: MGP_CAROLIEiJ_G0016063
UniProt: A0A6P5QNC4
LinkDB
Position
11
AA seq 465 aa
MAVDTTRRGAQSLTLVEQILAEFQLQEEDLKKVMSRMQKEMDRGLRLETHQEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRMVDESSVNPGQQLYEKIIGGKYMGE
LVRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRRQIRNILSTLGLRPS
VADCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggctgtggatactacaaggaggggagcccagtcgttgactctggtagagcagatcctg
gcagagttccagctgcaggaggaagacctgaagaaggtgatgagccggatgcagaaggag
atggaccgtggcctgaggctggagacccatcaggaggccagtgtaaagatgttgcccacc
tacgtgcgttccaccccagaaggctcagaagttggagactttctctccttagacctggga
ggaaccaacttcagggtgatgctggtgaaggtgggggagggggaggcaggacagtggagc
gtgaagacgaaacaccagatgtattccatccctgaggacgccatgacgggcactgcggag
atgctctttgactacatctctgagtgcatctctgacttcctggacaagcatcagatgaaa
cacaagaaactacccctgggcttcaccttctccttccctgtaaggcacgaagacatagac
aagggcatcctgctcaactggaccaagggcttcaaggcctccggagcagaagggaacaac
atcgtgggacttctccgagatgctatcaagaggagaggggactttgagatggatgtggtg
gcaatggtaaatgacacggtggccacaatgatctcctgctactatgaagaccgccaatgt
gaggtcggcatgattgtgggcactggctgcaacgcctgctacatggaagagatgcagaac
gtggagctggtggaaggcgatgaggggcgcatgtgtgtcaacacagagtggggcgccttc
ggggactccggtgagctggacgagttcctgctggagtacgaccggatggtggatgagagc
tcagtgaaccccggtcagcagctgtacgaaaagatcattggtggaaagtacatgggcgag
ctggtacgacttgtgctgctgaagctggtggacgagaatcttctgttccacggagaggcc
tcagaacagctgcgcacacgtggcgcttttgagacccgttttgtgtcgcaggtggagagc
gactctggggaccgaaggcagattcgtaacatcctgagcactctggggcttcgaccctct
gtcgccgactgcgacattgtgcgccgtgcctgtgaaagcgtgtccactcgcgccgcccac
atgtgctcagcaggactagcgggggtcataaatcgcatgcgcgaaagccgcagtgaggac
gtgatgcgcatcacggtgggcgtggatggctccgtgtacaagctgcacccgagcttcaag
gagcggtttcacgccagtgtgcgcaggctgacacccaactgcgaaatcaccttcatcgaa
tcagaggagggcagcggcaggggagccgcactggtctctgcagtggcctgcaagaaggct
tgcatgctgggccagtga

KEGG   Mus caroli (Ryukyu mouse): 110307543
Entry
110307543         CDS       T05910                                 

Gene name
Hk3
Definition
(RefSeq) hexokinase-3 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00010  Glycolysis / Gluconeogenesis
mcal00051  Fructose and mannose metabolism
mcal00052  Galactose metabolism
mcal00500  Starch and sucrose metabolism
mcal00520  Amino sugar and nucleotide sugar metabolism
mcal00524  Neomycin, kanamycin and gentamicin biosynthesis
mcal01100  Metabolic pathways
mcal01200  Carbon metabolism
mcal04066  HIF-1 signaling pathway
mcal04910  Insulin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04973  Carbohydrate digestion and absorption
mcal05230  Central carbon metabolism in cancer
Module
mcal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcal_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
mcal_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110307543 (Hk3)
   00051 Fructose and mannose metabolism
    110307543 (Hk3)
   00052 Galactose metabolism
    110307543 (Hk3)
   00500 Starch and sucrose metabolism
    110307543 (Hk3)
   00520 Amino sugar and nucleotide sugar metabolism
    110307543 (Hk3)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110307543 (Hk3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110307543 (Hk3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110307543 (Hk3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110307543 (Hk3)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    110307543 (Hk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110307543 (Hk3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110307543 (Hk3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110307543 (Hk3)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110307543 (Hk3)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 Cyanophycin_syn
Other DBs
NCBI-GeneID: 110307543
NCBI-ProteinID: XP_021035436
Ensembl: MGP_CAROLIEiJ_G0018549
UniProt: A0A6P5R0Z6
LinkDB
Position
13
AA seq 922 aa
MATIGPSGLHPGERASICPHEGVPRPSGSLELECLQQFKVTMTQLQQIQASLLCSMEQAL
KGQDSPAPSVRMLPTYVRSTPHGTEQGDFLVLELGATGASLRVLWVTLTGTKECRVEPRS
REFVIPQEVILGAGQQLFDFAARCLSEFLDAYPVENQGLKLGFNFSFPCHQTGLDRSTLI
SWTKGFRCSGVEGQDVVQLLRDAIQRQGTYRIDVVAMVNDTVGTMMGCELGTRPCEVGLI
VDTGTNACYMEEARHVAALDEDRGRTCVSIEWGSFHDEDALGPVLTTFDSALDRESLTPG
AQRFEKMIGGLYLGELVRLVLVHLTQNGVLFDGCTSPALLSQGCILLDHVAEMEDTATGT
ARVHTILQDLGLSPRASDAELVQCVCVAVCTRAAQLCAAALAAVLSRLQHSREQKTLQVA
VATGGRVFERHPRFLQILEETVMLLAPNCDVSFIPSVDGGGRGVAMVTAVAARLAAHRRI
LEETLAPFQLTLEQLTVVQAQMREAMIRGLQGEASSLRMLPTYVRATPDGSERGDFLALD
LGGTNFRVLLVQVAEGSVQIINQVYSIPEFVAQGSGQKLFDHIVDCIVDFQKRQGLSGQS
LPLGFTFSFPCKQLGLDQGILLNWTKGFNASGCEGQDVVYLLREAIRRRQAVELNVVAIV
NDTVGTMMSCGYDDPRCEMGLIVGTGTNACYMEELRNVSSVPGDSGLMCINMEWGAFGDD
GSLGTLSTRFDTSVDQASINPGKQRFEKMISGMYLGEIVRHVLLHLTNLGVLFRGQKTQR
LQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLTLTSDDALMVLEVCQAVSRRAAQLCG
AGVAAVVEKIRENRGLQELTVSVGVDGTLYKLHPHFSRLVSATVRKLAPQCTVTFLQSED
GSGKGAALVTAVACRLTQMAHV
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggccaccattgggccttctggcctgcatcctggagagagagcctcaatctgcccacac
gagggcgtgccaaggccctcaggtagcttagaactggaatgcttgcagcaattcaaggtg
accatgacacagttgcagcagatccaagccagtctcctgtgctccatggagcaggcactg
aagggacaggacagtcccgctccttctgtccggatgctgcccacatacgtgaggtccaca
ccacatggcaccgagcaaggggatttcctggtgctggagctgggggccacaggagcatca
ctacgtgtgttgtgggtaacactgacaggcaccaaagaatgccgtgtggagcccaggagc
cgggagttcgtgattcctcaagaggtgatcctaggtgctggccagcagctctttgacttt
gctgcccgctgcctctctgaattcctggatgcgtaccccgtggagaatcagggtctgaag
cttgggttcaatttctcttttccttgtcaccagacaggcttggacaggagcaccctcatt
tcctggacaaaaggttttaggtgcagtggcgtggaaggccaggatgtggtccagttgcta
agagatgccattcagaggcaggggacctacaggattgatgtggtagccatggtgaatgac
acggtgggcaccatgatgggctgtgagctgggcaccaggccgtgtgaagttgggctgatt
gtagacaccggtaccaacgcgtgctacatggaggaggcgcggcacgtggccgctctggat
gaggaccgcggccgcacctgtgtcagcatcgagtggggctccttccatgacgaagatgcc
ctagggccagtactgaccaccttcgactctgccctggaccgcgagtccctgactcctggt
gctcaaaggtttgagaagatgattggaggcctttacctgggtgagctggtgaggctggtt
ctggtccacttgacccagaacggggtcctttttgatggctgcacctctcctgcgttgctg
agtcaaggctgtatcctcctggaccacgtggctgagatggaggacaccgccactgggaca
gcccgcgtccacaccatcctgcaggacttgggtctgagccctcgggcctcagatgctgaa
ctggtgcaatgtgtatgcgtggctgtgtgcacacgggctgcccagctctgtgcggctgcc
ctggctgcagtcctctcccgcctccagcacagcagggagcagaagacattgcaagtggct
gtggccactggagggcgagtgtttgaacgacaccccaggttcctccaaatcctagaggag
acggtaatgctcctggccccaaactgtgatgtctccttcatcccctctgtggatggtggt
ggccggggtgtggcaatggtgacagctgtggctgcccgcctggctgctcacaggcgcatc
ctggaagagaccctggcaccatttcagctgaccttggagcagctgacagtggtgcaggca
caaatgcgggaagccatgatcagggggcttcaaggagaggcctcctccctccgcatgctg
cccacttacgtccgagcgacgcccgacggcagcgagcgaggtgatttcctggccttggac
ctagggggcaccaacttccgtgtcctgttggtacaagtggccgagggcagtgtgcagatc
atcaaccaggtctactccattcctgagtttgtagcccagggctctggacagaagctcttt
gaccatattgtggactgcatcgtggacttccagaagaggcagggccttagtggacagagc
ctacccctgggtttcaccttctctttcccatgcaagcagcttggcctggaccagggcatc
ctcctgaattggactaaggggttcaatgcatcaggctgtgagggccaggatgttgtgtat
ctattacgggaagccattaggcgcagacaggcagtggagctgaatgtggttgccattgtc
aatgacacggtggggaccatgatgtcctgtggctatgatgatccccgttgtgagatgggc
ctcattgtcggaaccggcaccaacgcctgttacatggaagagctccgaaatgtgtcaagt
gtgcctggggactcgggcctcatgtgcatcaacatggagtggggtgcctttggggatgat
ggctcactgggcacactcagcacccgctttgacaccagtgtggaccaggcatccatcaat
ccaggcaaacagaggtttgagaaaatgattagcggtatgtacctgggggagatcgtccgc
catgtcctcctgcacttaaccaatctcggagttctcttccgaggccagaagactcaacgt
cttcagaccagggacatctttaagaccaagttcctctctgagattgaaagtgacagcctg
gccctgcgacaggtccgagccatcctggaggatctggggctgactctgacatctgatgac
gccttgatggtcctggaagtgtgccaggctgtgtctcgcagggctgcccaactctgtggg
gcaggtgtggctgccgtggtggaaaagatacgggagaaccggggcctgcaggagctgaca
gtgtctgtgggagtagatgggacactctacaagctacatcctcacttctccaggctggtg
tcggcaacagtcaggaagctagcccctcagtgcaccgtcacctttttgcagtcggaggat
gggtctggcaaaggcgcagctttggttactgctgttgcttgtcgccttacccagatggcc
cacgtctga

DBGET integrated database retrieval system