KEGG   Mus caroli (Ryukyu mouse): 110296344
Entry
110296344         CDS       T05910                                 

Gene name
Gadd45a
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110296344 (Gadd45a)
   04064 NF-kappa B signaling pathway
    110296344 (Gadd45a)
   04068 FoxO signaling pathway
    110296344 (Gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110296344 (Gadd45a)
   04210 Apoptosis
    110296344 (Gadd45a)
   04115 p53 signaling pathway
    110296344 (Gadd45a)
   04218 Cellular senescence
    110296344 (Gadd45a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296344 (Gadd45a)
   05202 Transcriptional misregulation in cancer
    110296344 (Gadd45a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110296344 (Gadd45a)
   05212 Pancreatic cancer
    110296344 (Gadd45a)
   05225 Hepatocellular carcinoma
    110296344 (Gadd45a)
   05226 Gastric cancer
    110296344 (Gadd45a)
   05214 Glioma
    110296344 (Gadd45a)
   05216 Thyroid cancer
    110296344 (Gadd45a)
   05220 Chronic myeloid leukemia
    110296344 (Gadd45a)
   05217 Basal cell carcinoma
    110296344 (Gadd45a)
   05218 Melanoma
    110296344 (Gadd45a)
   05213 Endometrial cancer
    110296344 (Gadd45a)
   05224 Breast cancer
    110296344 (Gadd45a)
   05222 Small cell lung cancer
    110296344 (Gadd45a)
   05223 Non-small cell lung cancer
    110296344 (Gadd45a)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110296344 (Gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110296344 (Gadd45a)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110296344 (Gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110296344 (Gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae XPA_C
Other DBs
NCBI-GeneID: 110296344
NCBI-ProteinID: XP_021020667
Ensembl: MGP_CAROLIEiJ_G0028471
UniProt: A0A6P5Q2E7
LinkDB
Position
6
AA seq 165 aa
MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDAGPAESGGAAQTP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctgcagagcagaagaccgaaaggatggacacggtgggc
gatgccctggaggaagtgctcagcaaggctcggagtcagcgcaccattacggtcggcgtg
tacgaggctgccaagctgctcaacgtagaccccgataacgtggtactgtgcctgctggct
gcggacgaagacgacgaccgggatgtggctctgcagatccatttcaccctcatccgtgcg
ttctgctgcgagaacgacatcaacatcctgcgagtcagcaacccgggtcggctggctgag
ctgttgctactggagaacgacgcgggcccggcggagagcgggggcgccgcgcagaccccg
gacctgcactgtgtgctggtgacgaacccacattcatcacaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggtgcccgtgatt
aatctccccgaacggtga

KEGG   Mus caroli (Ryukyu mouse): 110303739
Entry
110303739         CDS       T05910                                 

Gene name
Gadd45b
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110303739 (Gadd45b)
   04064 NF-kappa B signaling pathway
    110303739 (Gadd45b)
   04068 FoxO signaling pathway
    110303739 (Gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110303739 (Gadd45b)
   04210 Apoptosis
    110303739 (Gadd45b)
   04115 p53 signaling pathway
    110303739 (Gadd45b)
   04218 Cellular senescence
    110303739 (Gadd45b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303739 (Gadd45b)
   05202 Transcriptional misregulation in cancer
    110303739 (Gadd45b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110303739 (Gadd45b)
   05212 Pancreatic cancer
    110303739 (Gadd45b)
   05225 Hepatocellular carcinoma
    110303739 (Gadd45b)
   05226 Gastric cancer
    110303739 (Gadd45b)
   05214 Glioma
    110303739 (Gadd45b)
   05216 Thyroid cancer
    110303739 (Gadd45b)
   05220 Chronic myeloid leukemia
    110303739 (Gadd45b)
   05217 Basal cell carcinoma
    110303739 (Gadd45b)
   05218 Melanoma
    110303739 (Gadd45b)
   05213 Endometrial cancer
    110303739 (Gadd45b)
   05224 Breast cancer
    110303739 (Gadd45b)
   05222 Small cell lung cancer
    110303739 (Gadd45b)
   05223 Non-small cell lung cancer
    110303739 (Gadd45b)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110303739 (Gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110303739 (Gadd45b)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110303739 (Gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110303739 (Gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 110303739
NCBI-ProteinID: XP_021030602
Ensembl: MGP_CAROLIEiJ_G0015612
UniProt: A0A6P5QJ62
LinkDB
Position
10
AA seq 160 aa
MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCL
LVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaccctggaagagctggtggcgagcgacaacgcggttcagaagatgcaggcggtgact
gccgcggtggagcagctgctggtggccgcgcagcgtcaggatcgcctcaccgtgggggtg
tatgaggcggccaaactgatgaatgtggaccctgacagcgtggtcttgtgcctcctggcc
atagacgaagaagaggaggatgatatcgctctgcagattcacttcaccctgatccagtcc
ttctgctgcgacaatgacattgacatcgtccgggtatcaggcatgcagaggctggcgcag
ctcctgggggaaccggcggagacactgggcacaaccgaagcccgagacctgcactgcctc
ctggtcacgaactgtcatacagattcctggaaaagccaaggcttggtggaggtggccagt
tactgtgaagagagcagaggcaataaccaatgggtcccctatatctctctggaggaacgc
tga

KEGG   Mus caroli (Ryukyu mouse): 110308191
Entry
110308191         CDS       T05910                                 

Gene name
Gadd45g
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110308191 (Gadd45g)
   04064 NF-kappa B signaling pathway
    110308191 (Gadd45g)
   04068 FoxO signaling pathway
    110308191 (Gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110308191 (Gadd45g)
   04210 Apoptosis
    110308191 (Gadd45g)
   04115 p53 signaling pathway
    110308191 (Gadd45g)
   04218 Cellular senescence
    110308191 (Gadd45g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308191 (Gadd45g)
   05202 Transcriptional misregulation in cancer
    110308191 (Gadd45g)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110308191 (Gadd45g)
   05212 Pancreatic cancer
    110308191 (Gadd45g)
   05225 Hepatocellular carcinoma
    110308191 (Gadd45g)
   05226 Gastric cancer
    110308191 (Gadd45g)
   05214 Glioma
    110308191 (Gadd45g)
   05216 Thyroid cancer
    110308191 (Gadd45g)
   05220 Chronic myeloid leukemia
    110308191 (Gadd45g)
   05217 Basal cell carcinoma
    110308191 (Gadd45g)
   05218 Melanoma
    110308191 (Gadd45g)
   05213 Endometrial cancer
    110308191 (Gadd45g)
   05224 Breast cancer
    110308191 (Gadd45g)
   05222 Small cell lung cancer
    110308191 (Gadd45g)
   05223 Non-small cell lung cancer
    110308191 (Gadd45g)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110308191 (Gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110308191 (Gadd45g)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110308191 (Gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110308191 (Gadd45g)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 110308191
NCBI-ProteinID: XP_021036239
Ensembl: MGP_CAROLIEiJ_G0018521
UniProt: A0A6P5QX60
LinkDB
Position
13
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGADEEGGAPGDLHCI
LISNPNEDTWKDPALEKLSLFCEESRSFNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgtggccaggatacagttccggaaagcacagccaggatgcag
ggcgccgggaaagcactgcacgaacttctgctgtcggcgcagcgccagggctgtctgacc
gctggcgtctacgagtccgccaaagtcctgaatgtggaccctgacaatgtgaccttttgc
gtgctggctgccgatgaagaagatgagggcgacatagcgctgcagatccatttcacgttg
attcaggcgttctgctgcgagaacgacattgatatcgtgcgcgtgggagacgtgcagagg
ctggcggcgatcgtgggcgccgacgaagaggggggcgcgccgggagacctgcattgcatc
ctcatttcgaatcctaatgaggacacatggaaggaccctgccttggagaagctcagtttg
ttctgcgaggagagccgcagcttcaacgactgggtgcccagcatcacccttcccgagtga

DBGET integrated database retrieval system