KEGG   Mus caroli (Ryukyu mouse): 110296420
Entry
110296420         CDS       T05910                                 

Gene name
Smo
Definition
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04340  Hedgehog signaling pathway
mcal04360  Axon guidance
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110296420 (Smo)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110296420 (Smo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296420 (Smo)
   05205 Proteoglycans in cancer
    110296420 (Smo)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110296420 (Smo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110296420 (Smo)
G protein-coupled receptors [BR:mcal04030]
 Frizzled / Smoothened family
  110296420 (Smo)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 110296420
NCBI-ProteinID: XP_021020791
Ensembl: MGP_CAROLIEiJ_G0028178
UniProt: A0A6P5Q2V6
LinkDB
Position
6
AA seq 793 aa
MAAGRPVRGPELAPRRLLQLLLLVLLGGPGRGAALSGNVTGLGPRSASGSARRNVPVTSP
PPPLLSHCGRAAHCEPLRYNVCLGSALPYGATTTLLAGDSDSQEEAHGKLVLWSGLRNAP
RCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPE
GCPNEVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAA
FGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCR
ADGTMRFGEPTSSETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGK
TSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGG
YFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFN
QAEWERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWV
WTKATLLIWRRTWCRLTGHSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSH
DGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEQANLWL
VEAEISPELEKRLGRKKKRRKRKKEVCPLGPAPELHHSAPVPATSAVPRLPQLPRQKCLV
AANAWGTGESCRQGAWTLVSNPFCPEPSPHQDPFLPGASAPRVWAQGRLQGLGSIHSRTN
LMEAELLDADSDF
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggccgctggccgccccgtgcgtgggcccgagctggcgccccggaggctgctgcaattg
ctgctgctggtgctgctggggggcccgggccggggggcggccttgagcgggaacgtgacc
gggcttgggcctcgcagcgccagcgggagcgcgaggaggaacgtgccggtgaccagccct
ccgccgccgctgctgagccactgcggccgggccgcccactgcgagcctttgcgctacaac
gtgtgcctgggctcggcgctgccctacggagccaccaccacgctgctggctggggactcg
gactcgcaggaggaagcgcacggcaagctcgtgctctggtccggtctccggaatgccccc
cgttgctgggcagtgatccagcccctgctgtgtgctgtctacatgcccaaatgtgagaat
gaccgagtggagttgcccagccgcaccctctgccaggccacccgaggcccctgtgccatt
gtggagcgggagcgagggtggcctgactttctgcgttgcacaccggaccacttccctgaa
ggctgcccaaacgaggtacaaaacatcaagttcaacagctcaggccaatgtgaagcaccc
ttggtgcggacagacaaccccaagagctggtacgaggacgtggagggctgtgggatccag
tgtcagaacccgctgttcacggaggccgagcaccaggacatgcacagctacatcgcagcc
ttcggggcggtcactggcctctgcacgctcttcacactggccacctttgtggctgactgg
cggaactccaatcgctaccctgcggttattctcttctatgtcaatgcgtgtttcttcgtg
ggcagcattggctggctggcccaattcatggatggtgcccgccgagagattgtttgccga
gcagatggcaccatgagatttggggagcccacctccagtgagaccctgtcctgtgtcatc
atctttgtcatcgtgtactatgccttgatggctggagtagtctggttcgtggtcctcacc
tatgcctggcacacctccttcaaagccctgggcaccacctaccagcctctctcgggcaag
acatcctatttccacctgctcacgtggtcactcccctttgtcctcacggtggcaatcctg
gctgtggctcaggtagatggagactccgtgagcggcatctgttttgtaggctataagaac
tatcggtaccgtgctggctttgtcctggccccaattggtctggtgcttattgtgggaggc
tacttcctcatccgaggggtcatgactctgttctccatcaagagcaaccaccctgggctt
ctgagtgagaaggcagccagcaagatcaacgagaccatgctgcgcctgggcatttttggc
ttcctggcctttggctttgtgctcatcaccttcagctgccacttctatgacttcttcaac
caggctgagtgggagcgtagcttccgggactatgtgctatgccaagccaatgtgaccatc
gggctgcctaccaagaagcccattcctgactgtgagatcaagaatcggcccagcctcctg
gtggagaagatcaatctatttgccatgtttggcactggcattgccatgagcacctgggtc
tggaccaaggccaccctgctcatctggaggcgcacctggtgcaggttgactgggcacagt
gatgatgagcccaagagaatcaagaagagcaagatgatcgccaaggccttctctaagcgg
cgtgagctgctgcagaacccgggccaggagctctccttcagcatgcacactgtctcccat
gatggacctgttgccggtttggcttttgacctcaatgaaccctcagctgacgtctcctct
gcctgggcccagcatgtcaccaagatggtggctcggagaggagccatattgccccaggat
gtgtccgttacccctgtggcaactccagtgccaccagaagaacaagccaacctgtggctg
gttgaggcagagatctccccagagttagagaagcgtttgggccggaagaaaaagcggagg
aagaggaagaaggaggtgtgccccttggggccagcccctgagcttcaccattctgcccct
gttcctgccaccagtgcagttcctcggctgcctcagctgcctcggcagaagtgcctggta
gctgcaaatgcctggggaacaggggagtcctgccgacagggagcctggactctagtctcc
aaccccttctgcccagagcctagtccccatcaagatccatttctccctggtgcctcagcc
ccccgggtctgggctcagggccgcctccaggggctgggatccattcattcccgcactaac
ctaatggaggctgagctcttggatgcagactcggacttctga

DBGET integrated database retrieval system