KEGG   Mus caroli (Ryukyu mouse): 110296731
Entry
110296731         CDS       T05910                                 

Definition
(RefSeq) 26S protease regulatory subunit 4-like
  KO
K03062  26S proteasome regulatory subunit T2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03050  Proteasome
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05169  Epstein-Barr virus infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    110296731
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110296731
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110296731
   05012 Parkinson disease
    110296731
   05014 Amyotrophic lateral sclerosis
    110296731
   05016 Huntington disease
    110296731
   05017 Spinocerebellar ataxia
    110296731
   05020 Prion disease
    110296731
   05022 Pathways of neurodegeneration - multiple diseases
    110296731
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110296731
   05165 Human papillomavirus infection
    110296731
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mcal03051]
    110296731
Proteasome [BR:mcal03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     110296731
SSDB
Motif
Pfam: AAA_lid_3 Prot_ATP_ID_OB
Other DBs
NCBI-GeneID: 110296731
NCBI-ProteinID: XP_021021144
UniProt: A0A6P5PX69
LinkDB
Position
6
AA seq 235 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKMKEPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIM
AKDDLSGADIKAICTEAGLMALREHRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggccatggtcctgggggtggcaagaaggatgacaaggac
aagaaaaagaaatacgaacctcctgtcccaactagagtggggaaaaagaagaagaaaatg
aaggaaccagatgctgccagcaaactgccactggtaacacctcacacccagtgccgcctg
aaattactgaagctagagagaataaaggattatcttctcatggaggaggaattcattaga
aatcaggaacagatgaaaccattagaagaaaagcaagaggaggaaagatcaaaagtggat
gatctcagggggacccccatgtctgtaggaaccttggaagagatcattgatgataatcac
gccattgtgtccacatctgtgggctctgaacactacgtcagcatacttatcaggccaggc
cgcattgacaggaagatcgagttcccgctgcctgatgagaagaccaagaagcggatcttc
cagattcacacgagcaggatgacactggctgatgacgtaaccttggatgacttgatcatg
gcaaaggatgacctctctggggccgacatcaaggcaatctgtacagaagctggcttgatg
gccttgcgggaacacagaatgaaagtaacaaatgaagacttcaaaaaatctaaagagaat
gttctttataaaaaacaagaaggcacccctgaggggctgtatctctag

KEGG   Mus caroli (Ryukyu mouse): 110306580
Entry
110306580         CDS       T05910                                 

Gene name
Psmc1
Definition
(RefSeq) 26S protease regulatory subunit 4
  KO
K03062  26S proteasome regulatory subunit T2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03050  Proteasome
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05169  Epstein-Barr virus infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    110306580 (Psmc1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110306580 (Psmc1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110306580 (Psmc1)
   05012 Parkinson disease
    110306580 (Psmc1)
   05014 Amyotrophic lateral sclerosis
    110306580 (Psmc1)
   05016 Huntington disease
    110306580 (Psmc1)
   05017 Spinocerebellar ataxia
    110306580 (Psmc1)
   05020 Prion disease
    110306580 (Psmc1)
   05022 Pathways of neurodegeneration - multiple diseases
    110306580 (Psmc1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110306580 (Psmc1)
   05165 Human papillomavirus infection
    110306580 (Psmc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mcal03051]
    110306580 (Psmc1)
Proteasome [BR:mcal03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     110306580 (Psmc1)
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_2 AAA_22 DUF815 RuvB_N AAA_16 AAA_5 AAA_18 AAA_25 IstB_IS21 AAA_28 AAA_3 ATPase AAA_33 RNA_helicase AAA_14 TIP49 Mg_chelatase NACHT PhoH AAA_7 AAA_24 ABC_tran AAA_30 AAA_17 TsaE Parvo_NS1 Sigma54_activat
Other DBs
NCBI-GeneID: 110306580
NCBI-ProteinID: XP_021034309
Ensembl: MGP_CAROLIEiJ_G0018019
LinkDB
Position
12
AA seq 377 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEHAVIGVLMDDTDPLVTVMKVEKAPQET
YADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQT
SATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTXRYDSNSGGER
EIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKR
IFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSK
ENVLYKKQEGTPEGLYL
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggccatggtcctgggggtggcaagaaggatgacaaggac
aagaaaaagaaatacgaacctcctgtcccaactagagtggggaaaaagaagaagaaaacg
aagggaccagatgctgccagcaaactgccactggtaacacctcacacccagtgccgcctg
aaattactgaagctagagagaataaaggattatcttctcatggaggaggaattcattaga
aatcaggaacagatgaaaccattagaagaaaagcaagagcacgctgtgataggggtgcta
atggatgacacggatcccctggtcacagtgatgaaggtggaaaaggccccccaggagacc
tacgcagatatcgggggactggacaaccagatccaagaaattaaggagtctgtggagctc
ccgcttacccaccctgagtattacgaggagatggggataaagccccctaagggggtcatt
ctctacggtccgccaggaacaggtaaaactctattggccaaagcagtagcgaaccagact
tcagccactttcttgcgcgtggttggctcagagcttatccagaagtacctaggtgatggg
cccaaacttgttcgggagctcttccgggtcgctgaggagcatgcgccgtccatcgtgttc
attgatgagatcgacgccattgggaccnaaagatatgattcaaactctggaggtgagaga
gaaattcaacgaacaatgttggaactgttgaaccagttggatggatttgattcgagggga
gatgtaaaagttatcatggccacaaaccgaatagaaactttggacccagcacttatcagg
ccaggccgcattgacaggaagatcgagttcccgctgcctgatgagaagaccaagaagcgg
atcttccagattcacacgagcaggatgacactggctgatgacgtaaccttggatgacttg
atcatggcaaaggatgacctctctggggccgacatcaaggcaatctgtacagaagctggc
ttgatggccttgcgggaacgcagaatgaaagtaacaaatgaagacttcaaaaaatctaaa
gagaatgttctttataaaaaacaagaaggtacccctgaggggctgtatctctag

DBGET integrated database retrieval system