KEGG   Mus caroli (Ryukyu mouse): 110296815
Entry
110296815         CDS       T05910                                 

Definition
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04932  Non-alcoholic fatty liver disease
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05134  Legionellosis
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05222  Small cell lung cancer
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110296815
   04215 Apoptosis - multiple species
    110296815
   04115 p53 signaling pathway
    110296815
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296815
  09162 Cancer: specific types
   05210 Colorectal cancer
    110296815
   05222 Small cell lung cancer
    110296815
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110296815
   05012 Parkinson disease
    110296815
   05014 Amyotrophic lateral sclerosis
    110296815
   05016 Huntington disease
    110296815
   05017 Spinocerebellar ataxia
    110296815
   05020 Prion disease
    110296815
   05022 Pathways of neurodegeneration - multiple diseases
    110296815
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110296815
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110296815
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110296815
   05134 Legionellosis
    110296815
   05152 Tuberculosis
    110296815
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110296815
   05161 Hepatitis B
    110296815
   05160 Hepatitis C
    110296815
   05164 Influenza A
    110296815
   05162 Measles
    110296815
   05168 Herpes simplex virus 1 infection
    110296815
   05163 Human cytomegalovirus infection
    110296815
   05167 Kaposi sarcoma-associated herpesvirus infection
    110296815
   05169 Epstein-Barr virus infection
    110296815
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110296815
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110296815
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 110296815
NCBI-ProteinID: XP_021021258
Ensembl: MGP_CAROLIEiJ_G0028373
UniProt: A0A6P5PXF2
LinkDB
Position
6
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggcaagaagatttttgttcagaagtgtgcccagtgccacact
gtggaaaagggaggcaagcataagactggaccaaatctccatggtctgttcgggcggaag
acaggccaggctgctggattctcttacacagatgccaacaagaacaaaggcatcacctgg
ggagaggataccctgatggagtatttggagaatcccaaaaagtacatccctggaacaaaa
atgatcttcgctggaatcaagaagaagggagaaagggcagacctaatagcttatcttaaa
aaggctactaatgagtaa

KEGG   Mus caroli (Ryukyu mouse): 110303728
Entry
110303728         CDS       T05910                                 

Definition
(RefSeq) cytochrome c, somatic-like
  KO
K08738  cytochrome c
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04932  Non-alcoholic fatty liver disease
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05134  Legionellosis
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05222  Small cell lung cancer
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110303728
   04215 Apoptosis - multiple species
    110303728
   04115 p53 signaling pathway
    110303728
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303728
  09162 Cancer: specific types
   05210 Colorectal cancer
    110303728
   05222 Small cell lung cancer
    110303728
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110303728
   05012 Parkinson disease
    110303728
   05014 Amyotrophic lateral sclerosis
    110303728
   05016 Huntington disease
    110303728
   05017 Spinocerebellar ataxia
    110303728
   05020 Prion disease
    110303728
   05022 Pathways of neurodegeneration - multiple diseases
    110303728
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110303728
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110303728
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110303728
   05134 Legionellosis
    110303728
   05152 Tuberculosis
    110303728
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110303728
   05161 Hepatitis B
    110303728
   05160 Hepatitis C
    110303728
   05164 Influenza A
    110303728
   05162 Measles
    110303728
   05168 Herpes simplex virus 1 infection
    110303728
   05163 Human cytomegalovirus infection
    110303728
   05167 Kaposi sarcoma-associated herpesvirus infection
    110303728
   05169 Epstein-Barr virus infection
    110303728
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110303728
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110303728
SSDB
Motif
Pfam: Cytochrom_C Cytochrom_C550 Cytochrome_CBB3
Other DBs
NCBI-GeneID: 110303728
NCBI-ProteinID: XP_021030588
UniProt: A0A6P5QJ11
LinkDB
Position
10
AA seq 105 aa
MGDVEKGKNVFVQKCAQCYTVGKGGKYKNVPNLHGLSGWKAGQAAGFSYTDANKNEGITC
GQDALMEDLENLKIISLEQKMIFAGTKKKGKMAGLIAYLKMATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggcaagaatgtttttgttcagaagtgtgcccagtgctacact
gtgggaaagggaggcaagtataagaatgtacctaacctccatggtctgtctggttggaag
gcaggtcaggctgctggattctcttacacagatgccaacaagaatgaaggcatcacctgt
ggacaggatgccctgatggaggatttggagaatctcaaaattatatccctggaacaaaaa
atgatctttgctggaactaagaagaaagggaaaatggcaggcctaatagcttatcttaaa
atggctactaatgagtaa

KEGG   Mus caroli (Ryukyu mouse): 110309371
Entry
110309371         CDS       T05910                                 

Definition
(RefSeq) cytochrome c, testis-specific
  KO
K08738  cytochrome c
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04932  Non-alcoholic fatty liver disease
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05134  Legionellosis
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05222  Small cell lung cancer
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110309371
   04215 Apoptosis - multiple species
    110309371
   04115 p53 signaling pathway
    110309371
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309371
  09162 Cancer: specific types
   05210 Colorectal cancer
    110309371
   05222 Small cell lung cancer
    110309371
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110309371
   05012 Parkinson disease
    110309371
   05014 Amyotrophic lateral sclerosis
    110309371
   05016 Huntington disease
    110309371
   05017 Spinocerebellar ataxia
    110309371
   05020 Prion disease
    110309371
   05022 Pathways of neurodegeneration - multiple diseases
    110309371
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110309371
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110309371
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110309371
   05134 Legionellosis
    110309371
   05152 Tuberculosis
    110309371
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110309371
   05161 Hepatitis B
    110309371
   05160 Hepatitis C
    110309371
   05164 Influenza A
    110309371
   05162 Measles
    110309371
   05168 Herpes simplex virus 1 infection
    110309371
   05163 Human cytomegalovirus infection
    110309371
   05167 Kaposi sarcoma-associated herpesvirus infection
    110309371
   05169 Epstein-Barr virus infection
    110309371
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110309371
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110309371
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Dehyd-heme_bind
Other DBs
NCBI-GeneID: 110309371
NCBI-ProteinID: XP_021037651
Ensembl: MGP_CAROLIEiJ_G0023685
UniProt: A0A6P5QZZ3
LinkDB
Position
2
AA seq 105 aa
MGDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW
SEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKEATSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatgctgaagcaggcaagaagatctttgttcagaaatgtgctcagtgccacacg
gtggaaaaaggcgggaaacacaagacaggtccaaatctctggggcctctttggccgaaag
acaggacaagcaccaggattttcgtacactgatgcaaacaagaacaaaggtgttatctgg
tcagaagaaactttgatggaatatttggagaacccgaagaaatatatccctggcactaaa
atgatctttgctggtatcaaaaagaagagtgagagagaagatcttattaagtatttaaaa
gaggccacatcctcatga

DBGET integrated database retrieval system