KEGG   Mus caroli (Ryukyu mouse): 110296846
Entry
110296846         CDS       T05910                                 

Gene name
Cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04151  PI3K-Akt signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04934  Cushing syndrome
mcal05162  Measles
mcal05165  Human papillomavirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05215  Prostate cancer
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110296846 (Cdkn1b)
   04066 HIF-1 signaling pathway
    110296846 (Cdkn1b)
   04068 FoxO signaling pathway
    110296846 (Cdkn1b)
   04151 PI3K-Akt signaling pathway
    110296846 (Cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110296846 (Cdkn1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296846 (Cdkn1b)
   05202 Transcriptional misregulation in cancer
    110296846 (Cdkn1b)
   05206 MicroRNAs in cancer
    110296846 (Cdkn1b)
   05203 Viral carcinogenesis
    110296846 (Cdkn1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    110296846 (Cdkn1b)
   05220 Chronic myeloid leukemia
    110296846 (Cdkn1b)
   05215 Prostate cancer
    110296846 (Cdkn1b)
   05222 Small cell lung cancer
    110296846 (Cdkn1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110296846 (Cdkn1b)
   04934 Cushing syndrome
    110296846 (Cdkn1b)
  09172 Infectious disease: viral
   05162 Measles
    110296846 (Cdkn1b)
   05169 Epstein-Barr virus infection
    110296846 (Cdkn1b)
   05165 Human papillomavirus infection
    110296846 (Cdkn1b)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110296846 (Cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110296846
NCBI-ProteinID: XP_021021293
Ensembl: MGP_CAROLIEiJ_G0028984
LinkDB
Position
6
AA seq 197 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIG
SQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPN
AGTVEQTPKKPGLRRQT
NT seq 594 nt   +upstreamnt  +downstreamnt
atgtcaaacgtaagagtgtctaacgggagcccgagcctggagcggatggacgccagacaa
gcggagcaccccaagccttccgcctgcagaaacctcttcggcccggtcaatcatgaagaa
ctaacccgggacttggagaagcactgccgggatatggaagaagcgagtcagcgcaagtgg
aatttcgactttcagaatcataagcccctggagggcagatacgagtggcaggaggtggag
aggggcagcttgcccgagttctactacaggcccccgcgcccccccaagagcgcctgcaag
gtgctggcgcaggagagccaggatgtcagcgggagccgccaggcggtgcctttaattggg
tctcaggcaaactctgaggaccggcatttggtggaccaaatgcctgactcgtcagacaat
ccggctgggttagcggagcagtgtccagggatgaggaagcgacctgctgcagaagattct
tcttcgcaaaacaaaagggccaacagaacagaagaaaatgtttcagacggttccccgaac
gctggcactgtggagcagacgcccaagaagccaggccttcgacgccagacgtaa

DBGET integrated database retrieval system