KEGG   Mus caroli (Ryukyu mouse): 110297010
Entry
110297010         CDS       T05910                                 

Gene name
Gli2
Definition
(RefSeq) zinc finger protein GLI2
  KO
K16798  zinc finger protein GLI2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04340  Hedgehog signaling pathway
mcal04390  Hippo signaling pathway
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110297010 (Gli2)
   04390 Hippo signaling pathway
    110297010 (Gli2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297010 (Gli2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110297010 (Gli2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110297010 (Gli2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110297010 (Gli2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 110297010
NCBI-ProteinID: XP_021021477
Ensembl: MGP_CAROLIEiJ_G0014510
UniProt: A0A6P5Q4E4
LinkDB
Position
1
AA seq 1547 aa
METSAPAPALEKKEAKSGLLEDSSFPDPGKKACPLAVAAAAAAVAAQGVPQQLLPAFHAP
LPIDMRHQEGRYHYDPHSVHSVHGPPTLSGSPVISDISLIRLSPHPAGPGESPFSAHHPY
VNPHMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPGTNPSDYYHQMT
LMASHPTPYGDLLMQSGGAASAPHLHDYLNPVDASRFSSPRVTPRLSRKRALSISPLSDA
SLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILN
QQRGLGSAFGHTPPLIQPSPTFLAQQPMTLTSISTMPTQLSSSSSNCLNDANQNKQNSES
AVSSTVNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEVVIYET
NCHWADCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHVRAPLLKENGDNE
ASAEPGGRGPEESVEASSTSHTVEDCLHIKAIKTESSGLCQSSPGAQSSCSSEPSPLGSA
PNNDSVMEMPGTGPGSLGDLTALDDTSPGADTSALAAPSTGGLQLRKHMTTMHRFEQLKR
EKLKSLKDSCSWAGPAPHTRNTKLPPLPANGSVLENFNNTGGGGPAGLLPGQRLPELTEV
TMLSQLQERRDSSTSTMSSAYTVSRRSSGISPYFSSRRSSEASPLGGLRPHNASSADSYD
PISTDASRRSSEASQCSGGGPGLLNLTPAQQYNLRAKYAAATGGPPPTPLPGLDRVSLRT
RLALLDAPERALPGACPHPLGPRRGSDGPTYSHGHGHGYVGAAPAFPHEGPNSSTRRASD
PVRRPDPLILPRVQRFHSTHNMNPGSLPPCSDRRGLHVQSHPSVDSNLTRNAYSPRPPSI
NENVVMEAVAAGVDGPGLECDLGLVEDELVLPDDVVQYIKAHTGGTLDDGIRQGYPTEGT
GFPENSKLPSPGLQGHRRLAAADSNMGPSAPGLGGCQLSYSPSSNLNKSNMPVQWNEVSS
GTVDALPTQVKPPPFPHSNLAVVQQKPAFGQYPGYNPQSVQSSSGGLDSTQPHLQLRGAP
SASRGSYTQQPRQPAAGSQCLGMSAAMSPQTSYSQAHPQLSPNIVSGSLNQFSPSCSNMA
AKPSHLGLPQQMEVVPNATIMNGHQRELGVPNSSLAAVSQPHPVLSYPQQDSYQQGSNLL
SSHQPGFMESQQNTGFGLMQPRPPLEPNTASRHRGVRSGQQQLYARTTGQPMATSANQET
AEAMPKGPAGTMVSLAPQPSQDTGQAQDQNTLYYYGQIHMYEQNGGCPAVQPQPPQPQAC
SDSIQPEPLPSPGVNQVSSTVDSQLLEPPQIDFDAIMDDGDHSSLFSGALSPTLLHNLSQ
NSSRLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT
NT seq 4644 nt   +upstreamnt  +downstreamnt
atggagacttctgccccagcccctgcactggagaagaaagaagccaagagtggtctcttg
gaggacagcagcttccccgacccagggaaaaaggcctgtcctctggcggtggccgcagcg
gccgcagctgtagccgcccaaggagttcctcagcagctcctgccggctttccacgcgcct
ttgccgattgacatgagacaccaggagggaaggtaccattatgaccctcactctgtccac
agtgtacacgggcctcccaccctaagtggcagccctgtcatctcagatatctccttgata
cgactttctccacaccctgctggccctggagaatcacccttcagcgcccaccacccctac
gtgaacccccatatggagcactacctccggtctgtgcacagcagccccacactctcaatg
atctctgccgccaggggcctcagccctgctgatgtggcccacgaacatctgaaagagagg
ggactctttagcctcgctgccccaggcaccaacccttcagactattaccaccagatgacc
ctcatggcaagccaccccaccccctatggggaccttctaatgcagagcgggggtgctgct
agcgcaccccatctccacgactacctcaaccctgtggatgcatcacgattctctagtcca
cgtgtgaccccgcgactgagccgcaagcgggctctatccatctccccgctctcagatgcc
agcctcgacctacaacgcatgattcggacctctcccaattcgctggtagcttacatcaac
aactccaggagcagctcagcagccagtggctcttatggacatctgtctgccggtgccctc
agcccagccttcactttcccccaccccatcaatcccgtggcctaccagcagatcctgaac
cagcagcggggcctgggctcagcctttggacacacaccacccctgatccagccttcaccc
accttcttggcccagcagcctatgactctcacctccatcagcaccatgcctacccaactc
agcagcagtagcagcaactgtctaaatgatgccaaccagaacaagcagaacagcgagtca
gctgtgagcagcaccgtgaaccccatcaccattcataagcggagcaaggtcaagactgag
gctgagggcctgcgtccagcctctccgcttgggctgacacaggagcagctggccgatctc
aaggaagacctggacagggatgactgtaagcaggaggccgaggtggtcatctatgagacc
aactgccactgggcagactgcaccaaggagtatgacacacaggagcagctggtgcatcat
atcaacaatgaacacatccacggggagaagaaggagttcgtgtgccgctggcaggcctgt
acgagagagcagaaacccttcaaggcccagtacatgctggttgttcacatgcgcagacac
acgggtgagaagccacacaagtgcacgttcgaaggctgttccaaagcctactctcgcctg
gagaacctgaagacacacctgcgttcacacacaggggagaagccatatgtgtgtgaacac
gaaggctgtaacaaagccttctccaatgcctcagaccgggccaaacaccagaaccgcact
cattccaacgagaaaccctacatctgcaagatcccaggctgcaccaagaggtacacagac
cccagctcactccgcaagcatgtgaagaccgtccatgggccagacgcccatgtcaccaag
aaacagcgtaatgatgtgcacgtccgtgctccgctgctcaaggagaatggggacaatgag
gccagcgccgagccaggtggccggggacctgaggagagtgtggaggccagtagcaccagc
cacactgtggaagactgcctacatatcaaagccatcaagacagagagctccgggctgtgt
cagtccagccccggggcccagtcatcctgcagcagtgagccctctcccctgggcagtgcc
cccaacaatgacagtgtcatggagatgccggggacagggcccgggagtctgggagacctg
acagcactggatgacacatctccaggagctgacacctcagccctggctgcaccctccact
ggtggcctgcagctgcgcaaacacatgaccaccatgcatcgctttgagcagctgaagaga
gagaagctcaagtcactgaaggattcctgctcgtgggccggcccagctccacacacccgc
aacaccaagctgcctccccttccagccaatggttctgtcctggaaaacttcaacaatact
gggggcggtggaccagcaggactgctgcccggccagcggctaccagagctgaccgaagtg
acgatgctgagccagctgcaggaacgaagagacagctccaccagcaccatgagctcggcc
tacactgtgagccgccgctcctctggcatctccccatacttctccagccgtcgctccagc
gaggcttcgcctctcggtggcctacgtccgcacaacgccagctcagcagactcgtatgac
cccatctccacagatgcctctcggcgctccagtgaagccagccagtgcagtggcggtggc
ccagggctgctcaacctcacacctgcgcagcagtacaacctgcgtgccaagtacgcagcg
gccacaggtggaccaccgcccacgccactgccgggcctcgatcgtgtaagccttcgtacc
cgcctggccttgctggatgctcctgagcgtgcactgcctggcgcctgcccacatccactg
gggccacggcgtggcagcgacgggcctacctatagccatggtcatggccatggctatgta
ggtgcagctccagcattcccccacgaggggccaaacagcagcacgcggcgggccagcgac
cctgtgcggcgccctgacccccttattctgcctcgagtgcagcgtttccacagtacccac
aacatgaatccaggttcactgccaccctgctctgatcggcgtggcctgcacgtacagagc
caccccagcgtagacagcaacctgacccgcaacgcctactctcccagaccccctagcatc
aatgagaacgtggtgatggaggccgtggctgctggggtagacggcccagggctagagtgc
gacctggggctggtggaagatgagctggtgctgccagatgatgtggtacagtacatcaag
gctcacaccggtggtaccttggatgacggcattcggcaggggtatcccacagaaggtact
ggcttccccgagaactctaaactgcccagtcctgggctacaaggccaccgcaggctagcc
gctgccgactccaacatgggtccttctgctcctggactcgggggctgccagctgagctac
agcccctcctccaacctcaacaagagcaacatgcctgtgcagtggaatgaggtgagttct
ggcaccgtggatgccctacctacccaggtgaagccacctcctttccctcacagcaacctg
gcggtggtccaacagaagccagcctttggccagtatccaggatataatccacaatccgtg
cagagcagctctggaggtctagacagcacccagccacacctacagcttcgaggagccccc
tctgcatcaagagggagctacacgcaacagcctcgacagccagctgcaggcagtcagtgc
ctgggtatgagtgcggccatgagcccgcagaccagctacagccaagcccacccccagctg
agcccaaacattgtcagcggatctctgaaccagttttctccctcctgtagcaatatggca
gccaagcccagccacctgggactccctcagcaaatggaagttgtccccaatgccaccatc
atgaatggccatcaacgggagcttggggttcccaattcatccctggctgcggtgtcacaa
cctcacccagtcctgagctatccccagcaggacagctaccaacagggctccaaccttctg
tcatcccatcagcctggcttcatggagtcccagcagaacacgggctttggtctcatgcag
cctcggccacccctggaacccaacacggccagccgtcaccgtggagtacgttctgggcaa
cagcagttgtatgccaggaccactggccaacccatggccacatcagccaaccaagagaca
gcagaagctatgcccaaggggccagcagggaccatggtatccctagctcctcagccatct
caggacacagggcaggcacaagatcagaacacgctatactactatggccagatccacatg
tatgaacagaatggaggctgcccagccgtgcagccccagccgccacaaccacaagcttgc
tcagacagtatccagcctgagcctctgccttcaccgggagtcaaccaggtgtctagcacc
gtggactcccagctcctggagcctccccagattgactttgatgccatcatggatgatggt
gatcactcaagtttgttttctggtgcactgagcccaacccttctccacaatctctcccag
aattcctcacgcctcaccacaccccggaattccttgacactgccctccatccctgcgggc
atcagcaacatggccgtgggggacatgagttccatgctcaccagcctggctgaagagagc
aagtttttaaacatgatgacctag

KEGG   Mus caroli (Ryukyu mouse): 110303011
Entry
110303011         CDS       T05910                                 

Gene name
Gli1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04024  cAMP signaling pathway
mcal04340  Hedgehog signaling pathway
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110303011 (Gli1)
   04024 cAMP signaling pathway
    110303011 (Gli1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303011 (Gli1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110303011 (Gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110303011 (Gli1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110303011 (Gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 VIR_N IL17
Other DBs
NCBI-GeneID: 110303011
NCBI-ProteinID: XP_021029553
Ensembl: MGP_CAROLIEiJ_G0015893
UniProt: A0A6P5QGI3
LinkDB
Position
10
AA seq 1112 aa
MFNPMTPPQVNSYGEPCCLRPLHSQGVPSMGTEGLSGLPFCHQANFMSGSQGYGAARETS
SCTEGSLFPPPPPPPRSSVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTS
PGGSYGHLSIGTMSPSLGFPPQMSHQKGTSPPYGVQPCVPHDSTRGSMMLHPQSRGPRAT
CQLKSELDMMVGKCPEDPLEGDMSSPNSTGTQDHLLGMLDGREDLEREEKPEPESVYETD
CRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHT
GEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEQEGCSKAFSNASDRAKHQNRTH
SNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAQPLSTVEPKR
EREGGSGREESRLTVPEGAMPQQSPGAQSSCSSDHSPAGSAANTDSGVEMAGNAGGSTED
LSSLDEGPCVSATGLSTLRRLENLRLDQLHQLRPIGSRGLKLPSLTHAGAPVSRRLGPPV
SLDRRSSSSSSMSSAYTVSRRSSLASPFPPGTPPENGASSLPGLTPAQHYMLRARYASAR
GSGTPPTAAHSLDRMGGLPVPPWRSRTEYPGYNPNAGVTRRASDPARAADHPAPARVQRF
KSLGCVHTPPSVATGRNFDPHLPTSVYSPQPPSITENVAMDTRGLQEEPEVGTSVMGNGL
NPYMDFSSTDTLGYGGPEGTAAEPYEARGPGPLPLGPGPPTNYGPGHCAQQVSYPDPTPE
TWGEFPSHAGMYPGNKAPGAAYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPS
EGSPGPQPLFSHHPQLPQPQYSQSGPYPQPPHGYLSTEPRPGLNFNPSSSHSTGQLKAQL
LCNYVQSQQELLWEGRNRGGLPNQELPYQSPKFLGGSQVSQSPAKTPAAAATAYGSGFAP
ASANHKSGSYPAPSPCHETFTVGVNRPSHRPAAPPRLLPPLSPCYGPLKVGDTNPSCGHP
EVGRLGAGPALYPPPEGQVCNALDSLDLDNTQLDFVAILDEAQGLSPPLSHEQGDSSKNT
PPPSGPPNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3339 nt   +upstreamnt  +downstreamnt
atgttcaatccaatgactccaccacaagtcaatagctatggtgagccatgctgtctccga
cccctccacagccaaggagtccccagcatgggaacagaaggactttctggtctgcccttt
tgccaccaagccaactttatgtcagggtcccagggttatggagcagccagagagaccagc
agctgcactgaaggatctctctttcctcctcctcctcctcctcctcggagttcagtcaaa
ttaacaaagaagcgggctctctccatctcacccctctctgatgccagcctcgacctgcaa
accgtaatcaggacctcacccagctccctggtggctttcatcaactctcgctgtacatct
ccgggcggttcctacggccatctctccattggtaccatgagcccttctttaggattccca
cctcagatgagtcatcaaaaaggaacttcacctccctatggagtccagccctgtgttcca
catgactctactcggggttcaatgatgcttcacccccagtcccggggaccacgtgcaacc
tgccagctgaagtcagagctggacatgatggttggaaagtgccctgaggaccctttggaa
ggggacatgtctagccccaactccacaggcacacaggatcacctgttggggatgctggat
gggcgggaggacctggagagagaggagaagcctgagcctgagtctgtgtatgagacagac
tgccgctgggatggttgcagccaggagttcgattcccaggagcagctcgtgcaccacatc
aacagtgagcatatccatggagagcggaaggaattcgtgtgccattggggaggttgctcc
agggagctgaggcccttcaaggcccaatacatgctggtggtgcacatgcgcagacacacg
ggcgagaagccacacaagtgcacgtttgaaggctgtcggaagtcctattcacgccttgaa
aacctcaagacgcaccttcggtcgcacacgggtgagaagccttacatgtgtgaacaagaa
ggttgcagcaaggcctttagcaatgccagtgaccgcgccaagcaccagaatcggacccac
tccaatgagaagccatacgtgtgcaagctccccggctgcaccaagcgctacacagatccc
agctcgctccgcaaacacgtgaagacagtgcatggtccggatgcccacgtgaccaagcgg
catcgaggggatggccccttgccacgggcgcagcccctttccacagtggagcccaagcgg
gaaagggaaggaggatccggcagggaagagagcagactgactgtgcccgagggtgccatg
ccacagcagagccctggagcacagtcctcctgcagcagcgaccactccccagcaggcagt
gctgccaacacagacagcggcgtggagatggccggcaacgccgggggtagcactgaggac
ttgtccagcttggatgaaggaccttgtgtctcggccaccggactctccacgcttcgccgc
ctggagaacctcaggctggatcagctgcatcagctccggcccatagggtctcggggtctc
aaactgcccagcttaacccacgctggcgcacctgtgtctcgccgtctgggccctccagtc
tccctggaccgccgcagcagcagctccagcagcatgagctctgcttacacagtcagccgc
aggtcctccctagcatcccctttcccgccgggaaccccaccagagaatggggcatcgtca
ctacctggcctcacacctgctcagcactacatgctccgtgccagatatgcttcagccagg
gggagtggcaccccgcccactgcagcgcacagcctggatcggatgggaggtcttccggtt
cctccttggagaagccgaaccgagtacccgggatacaacccaaatgcaggggtcacccgg
agggccagtgacccagcccgggctgctgaccacccagctccagccagagtccagaggttc
aagagcctgggatgtgtccacacgccccctagtgtggcaacgggacggaacttcgatccc
cacctccctacctctgtctattcgccacagccccccagcatcacagaaaatgttgccatg
gatactagggggctacaggaggagccagaggttggaacttccgtgatgggcaatggtctg
aacccatacatggatttttcctccactgatactctgggatatgggggacccgaggggaca
gcagctgagccttatgaagctaggggtccaggtcccctgcctcttgggcctggtccacca
accaactatggccctggccactgtgcccagcaggtctcctatcctgatcccaccccagaa
acctggggtgagttcccttctcatgctgggatgtaccctggcaataaggctccaggtgct
gcctatagccagtgtcctcgacttgagcattatggacaagtgcaggtaaaaccagaacaa
gggtgcccagtggggtctgactctaccggattggcaccctgcctcaatgcccaccccagt
gaagggtccccaggcccgcagcctctgttttcacatcacccccagctccctcagccccag
tattcccaatcgggtccctatcctcagcctccccatggttatctctcaacagaacccagg
cctggcctcaatttcaacccctcctcttctcattccacaggacagctcaaagctcagctc
ctgtgtaattacgttcagtcgcagcaggaattgttgtgggagggaagaaaccggggagga
ctccccaaccaggaactcccataccagagccccaagtttctggggggttcccaagttagt
cagagccctgccaagaccccagcagcagcagcgacggcatatggatctggctttgcacct
gcttcagccaatcacaaatcaggctcctatcctgccccttcaccctgccatgaaactttc
accgtgggagtaaacaggccttcccacaggccagcagcaccaccccgacttctgcccccg
ctgtccccttgctatgggcccctcaaggtgggggataccaaccccagctgtggccatcct
gaggtgggcaggttaggagcaggccctgccttgtaccctccccctgaagggcaggtgtgt
aatgctctcgactctcttgacctggacaacactcagctggactttgtggctatcctagat
gaggcccagggcctgagccctcctctttcccatgagcaaggggacagctctaaaaacacc
ccacctccctctgggccccccaacatggcagtgggtaacatgagtgtcttgctggggtct
ctgcctggagagacacaattcctcaactctagtgcctaa

KEGG   Mus caroli (Ryukyu mouse): 110308037
Entry
110308037         CDS       T05910                                 

Gene name
Gli3
Definition
(RefSeq) transcriptional activator GLI3
  KO
K06230  zinc finger protein GLI3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04024  cAMP signaling pathway
mcal04340  Hedgehog signaling pathway
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110308037 (Gli3)
   04024 cAMP signaling pathway
    110308037 (Gli3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308037 (Gli3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110308037 (Gli3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110308037 (Gli3)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110308037 (Gli3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 110308037
NCBI-ProteinID: XP_021036030
Ensembl: MGP_CAROLIEiJ_G0018241
UniProt: A0A6P5QWJ1
LinkDB
Position
13
AA seq 1583 aa
MEAQAHSSTATERKKAENSIGKCPTRTDVSEKAVASSTTSNEDESPGQIYHRERRNAITM
QPQSVQGLNKISEEPSTSSDERASLIKKEIHGSLPHLAEPSLPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVPSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADILPSAATAGAGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQSKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGSRGQQEQPEGTTLVKEEADKDESKQEPEVIYET
NCHWEGCTREFDTQDQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDMHPRPPPPRDSGSHS
QSRSPGRPTQGAFGEQKELSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSVADLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHIKL
ERLKQVNGMFPRLNPILPSKAPAVSPLIGNGTQSSNNYSSGGPGTLLPSRSDLSGVDFTV
LNTLNRRDSNTSTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQGEGLPSLLSLTPVQQYRLKAKYAAATGGPPPTPLPHMEKLSLKTKMALL
GEGRDSGVTLPPVHPPRRCSDGGGHTYRGRHLMPHDALANSVRRASDPVRTVSENMSLAR
VQRFSSLNSFNPPNLPPSVEKRSLVLQNYTRQENGQPRYFQASPCPPSITENVALEALTM
DADANLNDEDLLPDDVVQYLNSQNQAGYGQQLQSGISEDSKVAHEPEDLDLPGLPDSHVG
QQYAALEQPCSEGSKTDLPIQWNEVSSGSSDLSSSKLKCGQQRPSIQQPRGFGLYNNMVV
HPHNLWKVGTGPAGGYQTLGENSSTYNGPEHFAIHSGDGLGTNGNTFHEQPYKTQQYGSQ
LNRQPLTSSALDHACGAGIQGPKLKGNSLQENGGLLDFSLSVAPNELAGNTVNGIQTQDQ
MGQGYIAHQLLSGSLQHQGPSRPGQQVLGQVGATSHINIYQGTESCLPGTQDNSSQPASM
AAIRGYQPCASYGGNRRQAMPRGNLTLQQGQLSDMSQSSRVNSIKMEAQGQSQQLCSNVQ
NYSGQFYDQTMGFSQQDRKAGSFSLSDANCLLQGNGTENSELLSPGANQVTSTVDSFESH
DLEGVQIDFDAIIDDGDHTSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPSLSMGTTNM
AIGDMSSLLTSLAEESKFLAVMQ
NT seq 4752 nt   +upstreamnt  +downstreamnt
atggaggcccaggcccacagctctacggcgactgagaggaagaaagctgaaaattccatt
gggaaatgtcccacgagaacagatgtcagcgagaaggccgtggcctctagtaccacttcc
aatgaggatgaaagtcctggacagatctatcaccgagaaagaagaaacgcaatcactatg
cagcctcagagtgtgcagggtctcaacaaaatcagtgaggagccctcgacgtctagtgat
gagagggcctcgctgatcaagaaagagatccatggctctctaccacatctggcagagccc
tctctcccttaccgtgggactgtgtttgccatggatccccggaatggttacatggagcct
cactaccaccctcctcatcttttccctgccttccatcctcctgtaccaattgatgccaga
catcatgagggccgttaccattatgatccatctcctattcctccattacatgtgccttct
gccttatctagtagcccaacgtatccagacttgcccttcattaggatctccccacaccgt
aatcccaccgcagcctcagagtcccccttcagccccccacacccctacatcaacccatat
atggactacatccgctcattgcacagcagcccatccctctccatgatctcagctgcccga
gggctgagccctacagatgctccccatgctggagttagccctgcggaatactatcaccag
atggctctgctgacaggccagcgcagcccttatgcagacatccttccctcagctgccact
gctggtgcaggggccatccatatggagtaccttcatgccatggacagcaccagatttccc
agccctaggctgtcagctaggcccagccgaaagcgtacactgtcaatatcgccactgtca
gatcatagcttcgaccttcagaccatgataagaacatcccctaactccttggttacaatc
ctcaataattcccgtagcagctcttcagcaagtggttcctatgggcacttatcggcaagt
gcaatcagccctgcgttgagcttcacctacccttccgctcctgtgtctcttcacatgcat
caacagatcctaagccgacagcaaagcttaggctctgcatttggacatagccctcctctc
atccaccctgctccaacatttccaacacagagacctatccctgggattccgacagttctg
aaccccgtccaggtcagctctggcccttctgagtcctcacagagcaagcccacaagcgag
tctgcagtgagcagcactggtgaccctatgcataataagcggtccaagatcaagcctgat
gaagacctccccagcccaggatcacggggccagcaggaacagccggaaggaacaacccta
gtcaaggaggaagcggacaaagatgaaagcaagcaggagcctgaagtcatctacgagaca
aactgccactgggaaggctgcaccagagagttcgacacccaagatcagcttgtgcatcat
atcaataatgaccacattcatggagaaaagaaggagttcgtgtgccgctggcttgattgt
tcacgagagcagaaaccgttcaaagcccagtacatgttggtagtgcatatgagaagacac
actggggagaagcctcacaaatgtacatttgaaggttgcacaaaagcctactcaagactc
gaaaacctgaaaacccacttgagatctcacactggagagaagccatacgtctgtgagcat
gagggctgcaacaaggctttctctaatgcttcagatcgggccaagcaccaaaacagaaca
cattccaatgagaaaccatatgtatgcaagatccctggctgcaccaagcgttacacagac
cccagctctctccggaaacacgtgaagactgtgcatggccctgaggctcatgttaccaag
aagcagcgtggggacatgcaccctcggcctccacccccgagagattccggcagccattca
cagtccaggtcccctggccggccaactcagggagcatttggtgagcagaaggagctgagc
aacactacctcaaagcgggaagaatgcctccaggtgaagactgtcaaggctgagaagccc
atgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatc
agcaactattccaacagtgggctcgagcttcctctgactgatggaggtagtgtagcagac
ctcagtgcaatcgatgaaaccccaatcatggactcgaccatttccacggcaaccacagcc
cttgctttgcaagccaggagaaacccagcagggaccaaatggatggagcacatcaaactt
gaaaggctaaaacaagtgaatggaatgtttccaagactgaaccctattctaccctccaaa
gcccctgcggtatctcctctcataggaaatggcacacaatccagtaacaactatagttcg
ggtgggcccgggaccctcctcccgagcagaagtgacctgtcaggtgtagacttcacagtg
ctgaacacactcaacaggagagacagcaataccagcactatcagctctgcctacctgagc
agccgcagatcctcgggcatctccccctgcttttccagccgcaggtccagcgaggcgtcc
caggctgaagggcgaccccagaatgtgagtgtggctgactcctacgatcccatctccaca
gatgcttcaaggagatccagcgaggccagccagggtgaggggctgcccagtctgctcagc
ctcacacccgtgcagcagtaccgccttaaggccaagtatgcagctgccactggtggccca
ccacccacacctctgccccacatggaaaagctgagcctgaagaccaagatggccttgcta
ggggaagggagggactccggggtgaccctgcctccagtccatcctcctcgaagatgcagt
gatgggggaggccacacatacagaggccgtcacctgatgcctcatgatgcactagcgaac
agtgtgaggagagccagcgaccctgtgaggacagtctcggagaacatgtcacttgccagg
gttcaacgcttcagtagcctcaatagctttaatcctccaaatttgcctccatcggtggaa
aagcgtagcttagtgctgcaaaattatacccggcaggagaacggccaaccccggtacttc
caggcctccccttgccctcccagcatcacagagaatgttgccctggaggctctgaccatg
gatgctgatgctaacttgaatgatgaagacctcctgccagatgatgtggtacagtattta
aattcccagaaccaagcagggtatgggcagcagttgcagagtggcatctctgaagacagc
aaagtagcccatgaaccagaggacttggacttaccagggctgccagacagtcatgttggc
cagcagtacgcagctctggagcagccctgctctgagggcagtaaaactgatttgcccatc
cagtggaacgaggtcagttctggaagttctgatctgtcatcctccaagctgaaatgtggt
cagcagcgccctagcatacagcagcctcgggggtttgggctatacaacaatatggtggta
cacccacataatctgtggaaggttggcactggtccagctgggggatatcagaccctcggg
gagaatagcagcacctacaatggcccagagcactttgcaatccacagtggggacggactt
ggcaccaatggaaatactttccatgaacagccctataagacccagcagtatgggagccag
ctaaacaggcagccactgacttccagtgctctagaccatgcctgtggtgcagggattcaa
gggcccaagctaaaaggcaacagcttgcaagagaatgggggtttgctagatttcagcctg
tccgtggcaccaaatgagttagctggcaacacagtgaatggcatacaaacccaagatcaa
atgggacagggatacattgcccatcagctactcagtggcagtctgcaacaccaggggccc
agccgccctggtcaacaggtactagggcaggttggtgctacctcacatatcaacatctat
caagggacagagagctgcctaccagggactcaggacaacagcagccagccagcaagcatg
gcagcaatcaggggctaccagccctgtgccagctatgggggtaacaggcgtcaggcaatg
ccaaggggcaacctcactctgcaacaaggacagctcagtgacatgagtcagagcagcagg
gtgaacagcatcaaaatggaggcacaaggtcagtcccagcagctctgctctaacgtgcag
aattattccggtcagttctatgaccaaaccatgggcttcagtcagcaagacaggaaagct
ggctcgttctccctctcagatgccaactgcctgctccaagggaatggcactgaaaactct
gagttactatccccaggtgctaaccaggtaacaagcacagttgacagctttgagagtcat
gacctagaaggtgtgcagattgattttgatgccatcatagatgatggggaccataccagc
ctaatgtcaggggccttgagcccaagtatcattcagaacctttcccacagctcctcccgt
ctcaccactccacgggcatccctcccattcccatccctgtccatgggcaccaccaacatg
gctattggggatatgagttctttgctgacctcccttgcagaagaaagcaagttccttgca
gttatgcagtag

DBGET integrated database retrieval system